KEGG   Exaiptasia diaphana: 110231798
Entry
110231798         CDS       T05080                                 

Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
epa  Exaiptasia diaphana
Pathway
epa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110231798
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110231798
SSDB
Motif
Pfam: adh_short adh_short_C2 Gluconate_2-dh3
Other DBs
NCBI-GeneID: 110231798
NCBI-ProteinID: XP_028512702
Position
Unknown
AA seq 276 aa
MEALYEAVNCPQVAIAVVVVIIGTLYLVSKLIHGGRVQNPDNKYVLITGCDRGFGKMAAI
RLDQLGFHVIATCLTDESQKELKEEASNKLTTFRLDVTKSHQVQDVYHKVTALIPRNKGR
ACLPNAVAYSVSKFAAEAFSDALRREIADFGVKVSIVEPGFFQTPMVTKANLSNAWRDVW
NKLDKEKQEEYGEEFYXIQVENMLVGMVDTCCSPSTYKVIDAIEHAVTSTRPNSRYVIGW
DANLLWIWLSRLPASVGDFIVQMLANKRGVPRSLQK
NT seq 831 nt   +upstreamnt  +downstreamnt
atggaagctctgtacgaggctgttaactgtcctcaagtagcaattgccgttgtcgttgtg
ataataggaactctatacttggtttctaagcttatccacggtggtcgagtacaaaaccct
gataataaatatgtactcattactggttgtgatagaggattcggtaaaatggctgcaatt
cggttagatcagcttggttttcacgtaattgcgacctgcctgaccgatgaaagtcagaag
gagctaaaggaagaagcaagcaacaagttgactacattcagacttgatgtcactaaatcc
caccaagtacaagatgtatatcataaagttactgctcttattcctaggaataaaggtcgt
gcttgccttcctaatgcagtagcttatagcgtttctaagtttgcagctgaagcgttttcg
gatgcgctacgacgagaaatagctgattttggtgtcaaagtaagcatcgtggaaccaggt
ttttttcaaactccaatggttaccaaagcaaacctcagcaatgcgtggcgtgacgtatgg
aacaagcttgataaagaaaaacaggaagaatacggtgaagaattctacraaattcaagtc
gaaaacatgttggtgggtatggttgacacgtgctgttcgccaagcacctacaaagtgatt
gacgcgatcgaacatgccgtgacgtcaacacgacctaattctcgttacgtgattggctgg
gatgcaaacctattgtggatatggttgtcaaggttaccagccagtgttggtgatttcatt
gtgcagatgttggcgaacaagcgaggtgttccacgaagtttacaaaagtag

DBGET integrated database retrieval system