KEGG   Exaiptasia pallida: 110232327Help
Entry
110232327         CDS       T05080                                 

Definition
(RefSeq) cAMP-responsive element modulator-like isoform X1
  KO
K09052  cAMP response element modulator
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epa03000]
    110232327
Transcription factors [BR:epa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110232327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf EMP24_GP25L DUF3367
Motif
Other DBs
NCBI-GeneID: 110232327
NCBI-ProteinID: XP_020893161
Position
Unknown
AA seq 317 aa AA seqDB search
MEQIEDHSQVTEIENGTGISQGNPSIQQNSSQGIQGQSVIQTNQQSVIQSPPSTVHPSIQ
NSLQAQLQLNQQAVQVQAVPEGTDENAIDEDSKKRRDILSRRPSYRKIFNDLSSSDSPSK
IETIQEDSLEASDQNISAISTTAITYQQGSQTVTIPGTIQIVTSGGEAVQGLQAMPISAG
SGGAQATVVQYQAQQDGQQYIYTATPGEVQVQVSNTGTMYTIPAGQQQYIRAGQLQQGLV
LNSSGMSPNNQQVVAEEATRKREMRLMKNREAAKECRRKKKEYVKCLENRVAVLENQNKT
LIEELKALKDLYCHKSE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatcgaagaccattcacaagtaactgaaatcgagaatggtactggcataagt
caaggtaatccatcgatccaacaaaattcatcacaaggaatacaaggccaatcggtcatt
cagacaaatcaacagtccgtcatacagagccccccttcyacagtacacccttcaatacaa
aactcactacaagctcagttgcaattgaaccaacaagcagttcaagtccaagctgttcct
gaaggtacagacgagaatgcaattgatgaagacagtaagaaaagaagagatatcctttca
agaagaccgtcctacaggaaaatctttaacgacctgtcgagctctgacagtccatcaaaa
atcgagactattcaagaagatagtctagaggcatcagatcagaatatttctgcaatttca
acaacagcaattacctatcagcaaggatcacaaacagttactatacctggaacaatacag
atagtcacaagtggtggagaggctgttcaaggactgcaggctatgccaatatctgctggc
agtggaggagctcaagcaacagtagtacaataccaggctcaacaggacggtcaacaatat
atttatacagcaactccaggagaggtacaggttcaagttagcaatactggtacaatgtat
acaatcccagctggccagcaacagtacatacgagctggccaactgcagcaaggcttggta
ctcaactcaagtggaatgtctccaaataatcaacaagtagttgctgaagaagctacaaga
aaacgagaaatgagacttatgaaaaacagagaggctgctaaagaatgcagaagaaaaaag
aaggaatatgtcaagtgcttagaaaacagagtagcagttcttgaaaatcagaataaaact
cttatwgaggaacttaaggcgctgaaagacctttattgccacaaatcagagtaa

DBGET integrated database retrieval system