KEGG   Exaiptasia pallida: 110232888Help
Entry
110232888         CDS       T05080                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
epa  Exaiptasia pallida
Pathway
epa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110232888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110232888
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:epa03036]
    110232888
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110232888
Protein kinases [BR:epa01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   110232888
Chromosome and associated proteins [BR:epa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110232888
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Seadorna_VP7 DUF3859 Myosin_tail_1 ATG16
Motif
Other DBs
NCBI-GeneID: 110232888
NCBI-ProteinID: XP_020893761
Position
Unknown
AA seq 904 aa AA seqDB search
MEKRKELLERKVRDPRSELFVDGLLDGIEALVNDCNYPQIRRNKNVENFVQRYEGPSRII
QDNRLRSSDFXILKVIGRGAFGEVQLVRSKYTKKVYAMKLLSKFEMIKRSDSAFFWEERE
IMAHSNSDWIVKLHYAFQDEKYLYMVMDYMAGGDLVNLMSNYEIPEKWAKFYCAEVVLAL
DAIHSMGFIHRDVKPDNMLLDREGHLKLADFGTCMRMDKDGMVRSDTAVGTPDYISPEVL
KSQGGEGHYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYGKIMDHKNSLQFPEDIEMS
GQAKSLIKAFLIDRQQRLGTTGIHEIQQHKFFVNTEWDWNNIREAIPPVVPELIGDDDTS
NFDEIPEPDAGEEFFPIPKAFAGNHLPFIGFTYSKEARWTGGGXPADVLVSGDGHTYSNQ
NSSKEAEAAKLKIQQLESDLGIALTSKGDLENNLRAATAKLEKVLREFESEAEGRRNTEA
ANRELERDAAQMKYDLREIQRKLEYETDVKRKYEVKAQELQGRLDAELDARDKISQSSQN
VQTKITYLEKQIAELQANLKTESDGHAKNKKALGDLQKSYAVLERSYGDLQEKNRVLSDQ
KLSLERSHIKVQASLEAEFNMRVQANTAKADLESQYQAIKDEYEQLKARTASDAHLQQKL
QQDLINLEKAKANTEFELKSLQQKFDQATLDYKSQISSFMTEKKRLSLTLEEQHIQERVE
QSKTMERLKVEQELRAKAEAAAAEAERAKTVMAADYKDVTQKFERVKEELKALQEKSENT
NHKLIAESQKRAQLEGELEARTQELATTKSTESQIQKQMESILEEKRQLEEGYSKLKRMA
THILTRTQAEAAKLKIQQLESDLGIALTSKGDLENNLRAATAKLEKVLREFESEIVHESN
YVLI
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcgaaaagagttgctggagagaaaagtccgagacccaaggagtgagctattt
gttgacgggcttttggatggtatagaggcgcttgtgaacgattgtaactacccacagatt
cgtcggaacaagaatgttgagaacttcgtacaacggtatgaggggccgtcgagaattatc
caagataacagattacggtcgagcgattttcamattctcaaagtaatcggacgtggagct
tttggcgaagttcagttggttcggtcaaagtataccaagaaggtttacgctatgaagtta
ttgagcaagtttgaaatgattaaaaggtctgactcggctttcttctgggaggagcgagag
atcatggctcattctaacagtgattggattgtaaagcttcattatgccttccaagatgaa
aaatatctttacatggtcatggactacatggcaggtggagatcttgtcaatctcatgagt
aattatgaaatccctgagaaatgggccaagttctattgtgccgaggttgtgctggcaytg
gatgcaatacattcaatgggatttatacacagggatgtsaagccagacaacatgttatta
gatcgtgaaggccatttgaaattagcmgattttggaacttgtatgagaatggataaggat
gggatggtgaggtcagacactgctgttggaacccctgactatatatcacctgaggttctc
aagtcccaaggaggggaaggacattatggaagagaatgtgactggtggagtgtaggagta
tttttatatgaaatgcttgttggtgatacaccgttttatgcagattctttagttggaaca
tatggtaaaattatggatcacaaaaactcactacagtttccagaagacattgagatgtct
ggtcaagctaaaagccttattaaagcatttctwatagacagacaacaaagacttggaaca
actggcatccatgaaattcaacagcataaattcttcgtcaatacggaatgggactggaat
aatataagagaagcaatccctccagtggttcctgagcttattggtgatgatgacacttct
aattttgatgaaattcctgaacctgatgcaggagaagagttcttcccaatacccaaggca
tttgctggtaaccatctaccatttataggattcacatattcgaaggaagccaggtggact
ggtggtggtcycccagcagacgtcctggtaagtggggatggccacacatattctaaccag
aactcaagtaaagaggctgaagcagcaaagcttaaaattcaacaacttgaaagtgactta
ggaattgcacttacttctaaaggagatttggaaaacaatttaagagctgccactgctaag
cttgagaaagtgctcagagaatttgagagtgaggctgaaggccgtagaaatactgaggct
gcaaatagagaattagaaagagatgctgctcagatgaaatatgatcttagagagatccaa
agaaaattggaatatgaaactgatgttaaaagaaagtatgaagtcaaagcccaagaactt
cagggacgtctggatgcagagcttgatgcaagagacaagatctctcagtcatcacaaaat
gtccaaaccaaaattacgtatttagaaaaacagattgctgaattgcaagcaaacttgaag
actgaaagtgatggccatgcaaagaacaaaaaggctttgggagatctccaaaagtcatat
gcagttcttgaaagatcatatggagaccttcaggagaagaacagagtactaagcgaccag
aagttatcgctggaaagatcacatatcaaagttcaagctagtttagaagctgagttcaac
atgagagtccaagcgaacactgctaaagcagatcttgaatcacaatatcaagcaatcaaa
gatgaatatgaacaactcaaagcaaggactgcttccgatgcacatttacaacagaaactg
caacaagatttgatcaaccttgaaaaggctaaagccaatacagagtttgaactgaagtca
ttacagcagaagtttgatcaagcaacactggattacaagtctcaaatatcgtcattcatg
actgaaaagaagcgtttgtcactcacacttgaggagcagcacattcaagaacgagttgag
caaagtaaaacaatggaaagactcaaggtagaacaagaaytgagggccaaggctgaagcy
gctgctgctgaagcagagagagcaaagactgttatggctgcagattataaggatgttact
cagaagtttgagagagtgaaagaagaactcaaggctcttcaagagaagagtgagaacacc
aatcataaattgatagctgagtctcaaaaaagagcgcaacttgaaggagaacttgaggct
cgaacccaagaacttgcaacaaccaaaagtacagagagtcagatccaaaagcaaatggaa
agtatattggaagaaaaaaggcaacttgaagaaggttattctaaattaaagaggatggcc
acacatattctaaccagaactcaagctgaagcagcaaagcttaaaattcaacaacttgaa
agtgacttaggaattgcacttacttctaaaggagatttggaaaacaatttaagagctgcc
actgctaagcttgagaaagtgctcagagaatttgagagtgagatagttcatgaatctaat
tatgtattgatataa

DBGET integrated database retrieval system