KEGG   Exaiptasia pallida: 110234886Help
Entry
110234886         CDS       T05080                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
epa  Exaiptasia pallida
Pathway
epa00010  Glycolysis / Gluconeogenesis
epa00020  Citrate cycle (TCA cycle)
epa00620  Pyruvate metabolism
epa01100  Metabolic pathways
epa01200  Carbon metabolism
Module
epa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110234886
   00020 Citrate cycle (TCA cycle)
    110234886
   00620 Pyruvate metabolism
    110234886
Enzymes [BR:epa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     110234886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-GeneID: 110234886
NCBI-ProteinID: XP_020895952
Position
Unknown
AA seq 79 aa AA seqDB search
MFGIKNFSAVINPPQACILAVGSTEKAVIPDESSEKGYSVANVMSVTLSCDHRVVDGAVG
AQWLSTFKRYLENPLTMLL
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaattaaaaacttctcagctgttattaatccaccacaggcatgtatattagca
gtaggatctacagaaaaggctgtaattccagatgaaagcagtgaaaagggatacagtgta
gccaatgtaatgtcagtcacactcagctgtgaccaccgtgttgttgatggtgcagttggc
gctcaatggctttcaaccttcaaaagatatctggaaaaccctttaacaatgttactgtaa

DBGET integrated database retrieval system