KEGG   Exaiptasia pallida: 110235061Help
Entry
110235061         CDS       T05080                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
epa  Exaiptasia pallida
Pathway
epa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:epa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110235061
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:epa03041]
    110235061
Enzymes [BR:epa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     110235061
Spliceosome [BR:epa03041]
 Complex C
  Other components
   Step II factors
    110235061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_19 AAA_22 AAA_30 T2SSE AAA_14 ABC_tran PhoH
Motif
Other DBs
NCBI-GeneID: 110235061
NCBI-ProteinID: XP_020896146
Position
Unknown
AA seq 1219 aa AA seqDB search
MDELQQLEQISLVSKVCTELDNHLGIDDKVLAEFIIMLGEKSADVNEFKENLAKNGAEFP
DSFAANLLRLIEKMRPKQIKAEPGSSKVENNDDFPTNPEVQKRKKLFPGLSLPDKEIKEE
KEKISKEDEEIASAAFDELEALLPKASTSQSSDPDSDSKKYRNRSRSRSRSKSREKERKY
RDDKSSRSRHRSRSRSRSPARERRRDRDKDNRRRRSTSRDRHERYSDRDRHRDRDRDRDR
DRGRSSRHGTSYVEQAPPATPVANQIYGGKVTSLMPFGCFVQLEGLRGRHEGLVHVSELR
REGRVANVSDVVHRGLHVKVKVKSMAGNKISLSMKDVDQDTGEDLNPTKTKTGGRETSNM
FSNPDRPVGIPVVPTYDEEDAKLKRKVQRISSPEKWEIKQLISAGVLDKADYPDFDEETG
VLPKEDEGSDEDVEIELVDEEPSFLRGQTKLSVSMSPVKIVKNPDGSLQRAAMTQTALAK
ERRELKQAQREAQADSVPKDLGKLWVDPMPENSNDRPYFAQDMKGINLAANQDLPEWKKA
SFGGNKASFGKRSTLTILEQRQGLPIYKLRDELIKAIHSNQVLVVIGETGSGKTTQITQY
IAEHGFLASGKLACTQPRRVAAMSVAKRVSEEYGCRLGQEVGYTIRFEDCTSPETKIKYM
TDGMLLRECLIDSELKQYSVVMLDEAHERTIYTDVLFGLLKKAVKKRPDMKLIVTSATLD
AVKFSTYFFEAPIFTIPGRTFPVEILYTKEAESDYLDAALITVMQIHLTEPPGDILVFLT
GQEEIDTACEILYERCKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKCVIATNI
AETSLTIDGIYYVVDPGFVKQKVYNSKSGIDALVVTPISQAQGKQRSGRAGRTGPGKCYR
LYTERAYRDEMLPTAVPEIQRTNLASTILQLKAMGINDLLAFDFMDSPPLETMVAAMEQL
HSLSALDDEGLLTRLGRRMAEFPLEPQLSKMLIQSVHLGCSDEALTIVSMLSVQNVFYRP
KDKQAMADQKKAKFHQAEGDHLTLLAVYNSWKNNKFSNAWCFENFVQARSLRRAQDIRKQ
LLGLMDRHKLDVVSCGKNTARIQKTITSGFFRNAARKDPQEGYRTVVDNTVVYIHPSSAL
FNRQPEWVVYHELVLTTKEYMREVTTIDPKWLCEFAPSFFKVGDPTKLSKRKRHERLEPL
YNRYEEPNAWRISRAFRRR
NT seq 3660 nt NT seq  +upstreamnt  +downstreamnt
atggacgaactacagcaactggagcaratttcrcttgtttcaaaagtttgtacagagctt
gataaccatctcggtatagacgataaagtactggctgaattcattatcatgcttggagaa
aaaagtgctgacgtaaatgaattcaaagaaaacctagctaagaatggagctgaatttcct
gattcatttgccgctaacttactgagacttattgaaaagatgagaccaaaacagataaaa
gcagaaccaggttcttcaaaggtagaaaacaatgatgatttcccaacaaatcctgaagtg
cagaaaagaaaaaagttgtttcctggactttctcttcctgacaaggaaatcaaagaagaa
aaagagaagatatcaaaagaagatgaagaaatagcaagtgcagcatttgatgagttagag
gctcttctaccaaaagcatcaacttcacagtcaagtgaccctgactctgactccaaaaaa
tatagaaacagaagtaggagcaggagcagaagtaaaagcagagaaaaagaaagaaaatac
agggatgataaaagttctagatcaagacatagatcaagatcaagatctagaagtccagcc
agagaaagaagaagagacagagacaaagataataggagaaggagatcaacaagtcgtgat
agacatgaaagatattctgatagagacagacacagggatagagacagagatagagatagg
gatagaggacgaagcagtcgtcatggaacatcttatgtggagcaggctccaccagcaact
cctgttgccaatcagatatatggtggtaaagtgacaagtctgatgccatttggatgcttt
gttcaactggaaggcctgcgcggcaggcatgagggtcttgttcatgtttctgagcttcgc
cgtgaagggagagttgccaatgtctctgacgttgttcacagaggtctccatgttaaagtc
aaagtgaagtcaatggctgggaataaaatcagtctcagtatgaaggatgttgatcaggac
acaggtgaagatctgaatcccacaaaaaccaagactggtggcagagagacatctaatatg
ttcagtaatccagacagacctgttgggattcctgtggttcccacatacgatgaagaagat
gctaagctaaagcgtaaagtacagcgaatatcgtctccagagaaatgggagataaagcaa
ctcatctcagctggtgttctggacaaagctgattatcctgactttgatgaggaaactggt
gttttaccaaaagaagatgaaggatcagatgaggatgtcgagattgaattagttgatgaa
gaaccatctttcttacgtggacagacaaagctgagtgtgagcatgagccctgtcaagatc
gttaagaatcccgatggatctctacagcgtgctgcaatgacccaaactgcattggccaaa
gaaagacgagaattgaagcaggctcagagagaagctcaagcagacagcgtacccaaagac
ctsgggaaactctgggtagacccaatgcctgaaaayagcaatgatcggccgtatttcgca
caagacatgaagggaattaacttagcagccaatcaagaccttcctgagtggaagaaagca
agctttggtggcaacaaggcttcatttggtaaacgatcgactttaactattcttgaacaa
agacagggacttcccatctacaaacttagagacgaactaattaaggctattcattcaaat
caggtccttgttgttattggtgagactggtagtggaaaaacaacacaaatcactcaatac
atagcggagcacgggtttttagcgtccggtaaaytagcatgtacacagccaagaagagtt
gctgccatgtctgtagcaaagcgagtatctgaagagtatggctgtcgtttaggacaagar
gtcggctataccatccgtttcgaagattgcacaagtcctgagactaaaattaagtacatg
acagacggtatgctacttagagagtgtcttattgattcagaactgaagcagtattcagta
gtcatgcttgacgaagcccacgagagaactatctacactgacgttctgtttggtttactg
aagaaagcagtgaaaaagcgacctgatatgaagttaattgttacgtctgcaacgttagat
gctgtcaagttttctacgtatttctttgaggcgcccatttttactattcctggacgaacg
tttcctgtagagatcttgtacacyaaggaagcagagagtgactatcttgacgcagctctt
atcactgtgatgcagatccacttgactgaaccacctggtgacatccttgtcttccttaca
ggtcaagaagagattgatacagcttgtgaaattctttacgaacgatgcaagtctcttggt
cctgatgtccctgagttgattattcttcctgtgtacagtgctttaccaagtgagatgcaa
acacgaatctttgaccctgctccaccaggaagtagaaagtgtgttattgctactaacatc
gccgaaacatctctaaccatcgatggtatctactatgtggtcgatccagggtttgtcaaa
caaaaagtctataactctaagtctggtattgatgctctcgtagttacacctatctcacag
gcgcaaggtaagcaaagatctggtcgtgctggtagaactgggccaggtaaatgctatcgt
ttatacactgaacgagcttatcgagacgagatgctaccaacagccgtacctgagatccag
cgtacaaacctkgccagtacaatcctacagctgaaagctatgggtatcaatgatttgttg
gcttttgattttatggattcgccgccattggagaccatggtagcagcgatggaacaattg
cattcgctaagtgcattagacgatgaaggtcttttaactcgattgggtcgtcgaatggcc
gagtttcctcttgagccacagttatctaagatgttaattcagtcagttcacttgggatgt
agtgatgaagccytaactatagtgtctatgctatctgtacagaatgtcttttatcgacca
aaggataaacaagccatggccgaccaaaagaaagccaagttccaccaggctgagggagat
cacctaacgctgttagccgtgtacaattcctggaaaaataataaattctcaaatgcatgg
tgttttgagaattttgtccaggctagatcgctaagacgagcacaagatattcgaaaacag
ctgctagggcttatggacagacataaactagatgtcgtgtcgtgtggtaaaaacactgct
cgaatacagaaaaccatcaccagtggattcttcaggaacgctgcaagaaaggatccccag
gaggggtaccgtacggtggttgataacacagtggtatatatccacccatcgagtgcactg
tttaacagacagccagaatgggttgtctatcatgagttagttcttaccactaaagaatat
atgagagaggtaacgactattgatcccaagtggctgtgcgagttcgcgccgtcatttttc
aaagtgggtgatccaactaaactaagcaaacgaaagcgacacgaacgattagaaccgctc
tacaacaggtatgaagaaccaaatgcctggcgaatatcacgtgcattccgaagacgataa

DBGET integrated database retrieval system