KEGG   Exaiptasia pallida: 110235651Help
Entry
110235651         CDS       T05080                                 

Definition
(RefSeq) pyruvate carboxylase, mitochondrial-like
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
epa  Exaiptasia pallida
Pathway
epa00020  Citrate cycle (TCA cycle)
epa00620  Pyruvate metabolism
epa01100  Metabolic pathways
epa01200  Carbon metabolism
epa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110235651
   00620 Pyruvate metabolism
    110235651
Enzymes [BR:epa01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     110235651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp Biotin_lipoyl_2 ATP-grasp_3 ATPgrasp_ST RimK
Motif
Other DBs
NCBI-GeneID: 110235651
NCBI-ProteinID: XP_020896785
Position
Unknown
AA seq 1200 aa AA seqDB search
MLRLSSIQLKRISQQQFSRTAGIQTTCRYIHAGATLHQDSKREPRKQKIKKLMVANRGEI
AIRVFRAATEAGIRTVAIYSEQDANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKE
KEVDAIHPGYGFLSERADFARACTKNGVIFIGPSPRVVQMMGDKVEARKVATKAGVPVVP
GTENPIKTAEEAKAFCEEHGLPVITKAAYGGGGRGMRVIWNMDEVEEFFHLASNEAYAAF
GDGSMFIEKFVEKPRHIEVQVIGDAHGDVVHLYERDCSVQRRHQKIVEIAPAPLISPELR
QTLAEDAIRLCKEVGYENAGTVEFLIDQEGNHFFIEVNARLQVEHTVTEEITGIDLVRAQ
IGVAEGKSLNDLGLVQDNIRVTGSAIQARVTTEDPAMNFTPDTGRIEVFRSGEGMGIRLD
GASAFAGAIISPHYDSLLTKVISHGTDHKEAAQKLYRALTEFRIRGVKTNIAFLLNVLKH
DSFLDGTMTTDFIHQNPELFKVKKSQNRAQKLLQYLGNVMVNGPVTPLATGLKPSKDEPK
LPEVPYETHNSYLRPRGYRDLFLQDGPEGFARAVRRSNKLLLTDTTFRDAHQSLLATRVR
THDMVKIAPFVSHFFANAYSLECWGGATFDVALRFLYECPWDRLTKLREQIPNIPFQMLL
RGANAVGYTSYPDNVVFEFCQKAKDYGMDIFRVFDSLNYLPNLQLGIDAAGQAGAIVEAA
ISYSGDVTDPNRTKYNIDYYMDLASDLARSGAHVLCIKDMAGLLKPKAASLLIGALRAQF
PKLPIHVHTHDTSGAGVASMLAAAEAGADAVDVAVDSMSGMTSQPSMGAVVAALERGDHD
TGIPLHSVHEYSAYWEQTRLLYAPFECTVTMKSGNADVYENEIPGGQYTNLHFQAYSLGL
GDRFSEVKQKYVVANKLLGDLVKVTPTSKVVGDLAQFMVQNKLDERDVLAKAPELDFPSS
VVEFMQGYLGQPYGGFPEPLRSQIVKDKPVLEGRPGESLESLDFEDLKKKLQEDFGEDAG
IRDVDVLSAALYPKVFNDYMVFKEEFGPVEGLPTRLFFTGPEIGEEFQVEIEPGKVLNLK
VLAISDLHPNGMREVFCEMNGQLRSVMVQDKSATKTLVLRPKAEKTVKGSIGAPMPGKVV
GIRVKENEVVKKGMPLVVLSAMKMETNVSSPCDGMVKKISIALNNDVEAGDLLIDVEPNQ
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgctaagattaagctctatccagttgaagcgcatttctcagcagcaattttcccgcact
gcaggcatacagacaacatgccgttacatccatgctggtgcaacattgcatcaagactca
aagcgagaaccaagaaaacagaaaatcaaaaagttgatggtcgcaaatcgaggagagatt
gcaattagggtgtttcgtgctgcaaccgaagctggtatccgaactgttgcaatctactct
gagcaggatgccaatcacatgcataggcagaaggctgatgaggcatatttggttggcaaa
ggtatgccacctgtagctgcatatttgaacattcccgagattattagaattgcaaaggaa
aaagaggttgatgctattcatccaggctatggcttcctgtctgagcgagcagactttgcc
cgtgcctgtacaaagaatggagttatattcattgggccgtctccaagagtcgtgcagatg
atgggtgacaaagtagaagcaagaaaagttgccacaaaagctggagttcctgtggtgcct
ggaacagaaaatcccatcaaaacagccgaagaagccaaagcattctgtgaggaacatggg
ctacctgtcatcaccaaagcagcatatggtggaggagggcgtggtatgagggttatatgg
aatatggatgaagtagaggaattttttcatcttgccagtaatgaggcttatgctgctttt
ggtgatggatctatgtttatagagaagtttgtagagaaaccaagacatattgaagtccag
gttataggagacgcacacggagatgtagtacacctttatgagcgtgactgctctgttcag
cgacgtcaccagaaaatagtagaaatagcaccagcacctcttattagtccagaacttaga
cagactttggctgaagatgccatacgactatgtaaagaagtcggttatgaaaatgctggt
actgtagagtttttgattgaccaggaaggtaaccattttttcattgaagtcaatgcaaga
ctccaggtagaacatacagtcaccgaggagattacaggcattgacttggtaagagctcag
attggtgtcgctgagggaaaaagtttaaatgatctagggctggtccaagataatatacga
gtaacgggttcagctatacaagcaagagtgacgactgaagacccagcaatgaactttaca
cccgatacaggaagaattgaggtgtttaggagtggtgaaggcatgggtattcgtctagat
ggcgcgtcagcatttgccggtgccatcatttcccctcattacgactctcttttgaccaaa
gtgatcagtcatggcacggaccacaaggaagctgctcaaaaactgtacagagcgcttacc
gagtttaggattcgaggggtcaagaccaatatagctttcttactaaacgtcctaaagcat
gacagttttctagacggcacaatgactacagactttatccatcaaaacccagaattgttt
aaagttaaaaaaagtcagaatcgagctcaaaaacttctgcagtaccttggaaatgtaatg
gtcaatggtcctgtcactccgcttgctacgggcctgaaaccctctaaagacgaacctaaa
cttcccgaggtaccctacgaaacccataattcctatctacgtcctcgaggctatcgtgac
ctgttccttcaagatggtccagaaggctttgcacgcgctgttcgtcgaagcaacaagctt
cttttgacggatactacttttagagatgcacatcagtcgctccttgctacacgtgtcagg
actcacgacatggtcaagattgctccatttgtctcgcacttctttgctaatgcatacagc
ttggaatgctggggaggtgcaacgttcgacgtggccttgcgattcttgtacgagtgcccc
tgggaccgactgaccaaacttcgtgaacaaatacccaacattcctttccagatgttactt
cgtggcgcaaatgctgtcgggtacactagctatccggataacgtcgtgtttgagttctgt
cagaaggcaaaggattatgggatggacatctttagagtattcgattctctgaactactta
ccaaacttgcagcttggtatcgacgcagcaggacaagcaggagctatcgttgaagcagcc
atctcgtattctggtgatgtgactgacccaaatcgtactaaatataacatagattattac
atggatttggcatcagatctagcgaggtctggtgctcatgttctgtgcatcaaggacatg
gctggcttactaaaaccaaaagcagcgtctctactgattggcgctctccgtgcccagttc
cccaagctgccaatccacgtgcatacccatgatacatcgggtgctggagttgcgtccatg
ttggctgcggcggaagctggagccgatgccgttgatgtagcagtagattccatgtcaggc
atgacgtcacagcctagtatgggtgctgttgttgctgctttggagagaggtgaccatgat
acagggatcccattgcatagtgtacatgaatacagcgcttactgggaacaaacaagactt
ttatacgcacctttcgagtgtactgtcacaatgaagagtggaaatgccgacgtttatgag
aatgagataccaggtggtcaatacaccaatcttcatttccaggcgtatagccttggactg
ggagacaggttctcagaggtcaagcaaaagtacgtagtcgctaacaaactacttggagat
ctggtgaaggttactccaacatcaaaggtcgtgggagacttggcccagtttatggtgcaa
aataagctagacgagagagacgtgctagccaaagcaccagagcttgactttccttcatca
gttgtcgagttcatgcaaggatatcttggtcaaccctatggtggttttccagaacccttg
agatctcagattgtcaaagataaaccagtcttagaaggtcgcccaggcgagtcccttgag
agtcttgactttgaagatctcaaaaagaagctccaagaggactttggagaagatgcgggt
attagagacgtagacgtacttagtgctgctttatatcccaaagtatttaatgattacatg
gtatttaaggaggagtttggtccagttgaaggtctgccaaccagactcttttttactgga
ccggaaattggtgaagaattccaagttgaaatcgagcctggtaaagttttaaatcttaaa
gtgctcgccatcagtgatcttcatcccaacggtatgagagaagtgttctgcgagatgaat
ggtcagctgcgttccgttatggtgcaggacaaaagtgctactaagaccttagtgctgcgc
cccaaggcagaaaagaccgtcaagggatccattggtgctccaatgcccggtaaagttgtc
ggcattcgtgtcaaagaaaacgaagtcgtcaagaaaggcatgcctctagttgtactaagc
gccatgaaaatggagactaacgtatcgtcaccttgcgatgggatggtcaagaagatatcc
atcgctctaaacaatgacgtagaagcaggagacttacttattgacgtcgaaccaaatcag
tga

DBGET integrated database retrieval system