KEGG   Exaiptasia pallida: 110236901Help
Entry
110236901         CDS       T05080                                 

Definition
(RefSeq) protein henna-like
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
epa  Exaiptasia pallida
Pathway
epa00360  Phenylalanine metabolism
epa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
epa00790  Folate biosynthesis
epa01100  Metabolic pathways
epa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    110236901
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    110236901
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110236901
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     110236901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-GeneID: 110236901
NCBI-ProteinID: XP_020898119
Position
Unknown
AA seq 436 aa AA seqDB search
MNSKTEQPNTAEDQETIELGTKDLVIQFSLKKIDQGVTLSQVIHRVEEKNGIVVNIHSRQ
IKSGDKLEFLTEIAGIAKEDEAQFMEAIQPLVDDLSQHKITVPWFPRKIREIDVFAHRVK
KANEELKSDHPGFQDKEYRARRQEFEDIALSYKHGQLIPYMEYTPEEIKTWNTIFQCLTK
LFPTHACREFNDIWPFLVRECDYKLGSIPQLQVVSDFIKERSGFTLRPVAGLLSPRDFLA
GLAFRVFHSTQYIRHGSKPLYTPEPDVVHELVGHVPLLADPEFAEFSQEIGLASLGAPDD
WIDKLSTLYWFTVEFGLCKEGSEVKAYGAGLLSSFGELEYCLTDKPVKEIFFSEVTANTE
YPITNFFFKYFVAESFKSAREKLKSFAAQIPRPFSVRYNAFTQSIDVIENKDDLSRFGKE
LQTDLGSFMNALNRML
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaagaccgaacaacccaacacggccgaggaccaagagaccattgaactaggc
accaaagatttggtcatccaattttctttgaagaaaattgaccagggagtcactttgagt
caagttattcatcgtgttgaggagaaaaatggcatcgttgtcaacatccattcacgccaa
atcaagagcggtgataaactggaatttctcactgaaatagctggaatagcaaaggaagat
gaagcccaattcatggaagcaattcagccactggttgatgacttatcgcaacataaaatc
acagtgccttggtttccgaggaagatcagagaaattgatgtgtttgctcatcgcgtcaaa
aaagcaaacgaagaacttaagtctgaccaccctggttttcaagataaagaatacagggca
aggcgacaagagtttgaagatatagcactaagctacaagcatgggcagctcatcccttat
atggagtacacaccagaagaaattaagacatggaataccatatttcaatgtctgaccaag
cttttcccaactcatgcatgccgagagtttaacgacatctggccattcctcgtgagggaa
tgcgattacaagcttggaagtattccacaattacaagtggtttcagatttcatcaaagag
cgttcaggttttacactacgtcctgtagcaggtcttctgtcacccagagattttcttgck
ggattggcrttccgtgtgtttcatagcacrcagtatatacgacatggatcgaaacctctt
tacaccccagaacctgatgttgtacatgagcttgttggccatgtgcctttacttgctgat
ccagagtttgctgagttttcacaggagatcggccttgcttcacttggagcaccagatgac
tggattgacaaattgtcaactctttactggtttaccgtggagtttggactctgcaaagag
gggtctgaagtaaaagcatatggcgcgggcttgctgtcatcgtttggtgagctcgagtac
tgtctgactgataaaccggtcaaagagatttttttttctgaagttacagcaaacactgag
tatcctataaccaatttttttttcaaatacttcgtcgctgaaagtttcaagtctgctcgc
gagaaactcaagtcatttgctgctcaaattccccgtcctttcagtgtgcgctacaatgct
ttcactcagtcaattgacgtgattgagaataaagatgacttgagcagatttggaaaagaa
cttcagacagacctgggaagttttatgaatgcacttaacagaatgctgtaa

DBGET integrated database retrieval system