KEGG   Exaiptasia pallida: 110238334Help
Entry
110238334         CDS       T05080                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-2-like
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
epa  Exaiptasia pallida
Pathway
epa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110238334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110238334
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110238334
Protein kinases [BR:epa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110238334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Pkinase_fungal Toxin_TOLIP APH FTA2 EphA2_TM
Motif
Other DBs
NCBI-GeneID: 110238334
NCBI-ProteinID: XP_020899654
Position
Unknown
AA seq 559 aa AA seqDB search
MRVQQRFFAACLCCLLRFVVVYSNNEEETQSQVQHCQQYSDADPSINGTKVCEKGENSCF
ALWSTRKLQDNTTIGIVIRKGCFRISFDRPEIEHPCGADCIQRPDFDAMKKQKNVSGFCC
CNRDNCNKNFTMVEYEITTESPSNVTGYAKAEGNRIAIILSCIVGAVTILSIMVFGYIVI
RRKASNNLRAYGKADMEEKEPQKCTVDLSQLILLKRIGQGRYGTVWKASLHEKIVAVKVF
SPENRLFWQAELDFYRSLDLKSSLYILKFIDACEQPTDNFPNFLLLTEYHSQGSLRDYLH
RTVISWKEMCSLGYTMASGLAFIHQEQGSRPAFAHRDFNSKNILVKMDGTCALADFGFAM
KVPDATKPADDGTLITEVGTMRYMAPEVLDGAVNLQDIKGALKQIDIYAMALVLWEVAMR
CEDIFGKGKVPEYKLPFEAELGSMITSEAMHTFVVFKKARPGFPDAWKNNHPGIRALKET
IEDCWDQDADARLLALCVEDRIADLCNNCPGSCPDNLSVGNVQDFQHNFMVDTPETQLID
KNTMIVTIDKDKDHDATVV
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgagagttcaacagaggttcttcgctgcgtgtctgtgctgtcttcttcgatttgtcgtt
gtatattccaacaatgaagaagaaacacagagtcaagtccagcactgccaacagtactct
gatgccgacccatcaatcaatggtacaaaagtctgtgaaaaaggcgaaaactcatgtttt
gcgctktggtcaacaagaaarctacaagacaacaccaccataggcattgtgataagaaaa
ggatgttttagaatctcttttgacaggcctgaaatagaacatccatgtggagctgattgc
atacaaagacctgattttgatgctatgaaaaaacagaaaaatgtatcagggttttgttgt
tgtaatcgagacaactgtaataaaaacttcactatggttgaatatgaaattacaacagag
agtccctctaatgtaacaggctatgcgaaagctgaaggaaatagaattgcaatcatacta
agctgcattgttggagcagtaaccatattgtcaataatggtatttggatacatagtcata
cgcagaaaggcatctaataatctgcgtgcttatggcaaggctgacatggaagaaaaagaa
ccacaaaaatgtactgtagatttaagtcagttgatacttttaaaacggattggacaagga
agrtatgggactgtttggaaggccagtctacatgaaaaaattgttgcagtcaaagttttt
tctccagaaaatagactgttctggcaagcagagcttgatttctacagaagtttggatttg
aaaagtagtctgtacattctgaagtttattgatgcatgtgaacagccaactgataacttc
cccaacttccttcttctgactgagtaccactctcaaggatcactgcgtgattacttacat
cgtactgtgatcagttggaaagaaatgtgttcattagggtataccatggcatctggtctg
gccttcattcatcaggaacaaggatcaaggccagcgtttgcacatcgtgatttcaatagc
aagaacattttagtgaaaatggatggtacgtgtgctttrgcagattttggttttgcaatg
aaggtaccagaygcaaccaaacctgcagaygatggaactcttattaccgaagttggaact
atgaggtacatggcycctgaggttcttgatggtgcagtaaatcttcaggacatmaagggt
gcattaaarcaaattgacatctatgctatggcattagtcctgtgggaggttgcaatgcgc
tgtgaggacatatttggaaaaggcaaagtaccagaatataaattgccatttgaggctgaa
ttaggatccatgataacatcagaagccatgcatacatttgttgtattcaaaaaagcaaga
ccaggatttccagatgcctggaaaaataaccaccctggtataagagcactcaaagagact
atcgaagattgttgggatcaggatgctgatgccaggcttctagccctctgtgttgaggac
agaatagcagacctttgcaataattgtccaggctcgtgccctgacaacctctcagtgggt
aatgtccaggatttccagcacaatttcatggtagatacacctgaaacccaacttatagat
aaaaacaccatgattgtcaccatcgacaaggacaaagatcatgatgcaactgttgtgtag

DBGET integrated database retrieval system