KEGG   Exaiptasia pallida: 110238550Help
Entry
110238550         CDS       T05080                                 

Definition
(RefSeq) D-erythrulose reductase-like
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
epa  Exaiptasia pallida
Pathway
epa00040  Pentose and glucuronate interconversions
epa01100  Metabolic pathways
Module
epa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    110238550
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     110238550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Shikimate_DH NAD_binding_10 RmlD_sub_bind Epimerase 2-Hacid_dh_C 3Beta_HSD NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 110238550
NCBI-ProteinID: XP_020899887
Position
Unknown
AA seq 247 aa AA seqDB search
MEIIFKGKRALVTGAGKGIGRTAAKALAQCGAEVIALARTQADLDTLVKEVPSIKPLCVD
LCNIQEAVKAIEEQDDIHLLVNNAGVLIQSPFLDITEEQFDKVNSINMKGALFVAQAVAR
KMVSGGFGGAIVNVSSRSSIRASSNNGIYGPLKASLDMLTKVMALELGPHKIRVNSVNPT
FVNETRMADQGLGRLTPDERQAKINTLPLGKYPEKEDVVNAILYLLSDKAAMVNGVNLLV
DAGPFGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggagatcatctttaaaggaaagcgggcccttgttacaggggcagggaaaggtattggt
agaactgcagccaaggccttagcacaatgtggagccgaggttattgcattggcaaggaca
caagctgacctggacacccttgtaaaggaggtgccatccatcaagcccttatgtgtcgac
ctatgtaacattcaagaagcagtaaaagccattgaagaacaagatgacatccatcttctc
gtcaataatgctggtgttctcattcaaagcccatttctggatatcacagaagagcaattt
gacaaggttaattctatcaatatgaaaggcgctctatttgtcgcccaggcagttgctcgt
aagatggtttctggtgggtttggtggcgctattgtcaatgtgtctagtcgttcaagcata
agagcttcttcaaataatggtatttatggccccttaaaagcttcattagacatgttaact
aaagtaatggcactagaacttggaccacacaagatcagagtaaattctgttaatccaacc
tttgtgaatgagacaaggatggctgaccaaggattaggaaggctaacaccagatgaaaga
caagctaaaataaacacactgcctcttggaaaatacccagaaaaagaagatgttgtcaac
gccattttgtatctcctgagtgacaaagcagctatggttaatggtgttaatttattggtc
gatgccgggccttttggccgctag

DBGET integrated database retrieval system