KEGG   Exaiptasia pallida: 110238865Help
Entry
110238865         CDS       T05080                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
epa  Exaiptasia pallida
Pathway
epa00010  Glycolysis / Gluconeogenesis
epa00562  Inositol phosphate metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110238865
   00562 Inositol phosphate metabolism
    110238865
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110238865
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110238865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 WT1
Motif
Other DBs
NCBI-GeneID: 110238865
NCBI-ProteinID: XP_020900207
Position
Unknown
AA seq 464 aa AA seqDB search
MADVSLGTSFLPCRKYRIFSKKYWLFLLVIFLSVHLSYGSNXRLGFASKTPYFFKEVQSK
SHLSAECKVIHVNFLGRHGTRYPSHKDIKKINTMALLINHLHASHGGFAFDKVQFPWASP
FQEHHDKSLTERGEQELYDIAKRMRRRFPEFFNSNLTNDHLKFVSTQTSRTLKSAMAFSI
GLLEGTGKLGTCGIRPVDIESTDIHNDTILRFFDVCPKYLNTVSKNKTSLFEHHDFKHTQ
HMTEVVEHVRQQFGNNXAIMAKHVIGMFIACTFEYAVFDRSDTWCSVFRPEDINVMEYYY
DLKHFWKRGWGYEVNTKMACPLLSAMFTDIKSFLNXSDVHRKAGVFRFAHGETLQPLYCL
LGLFKDTEMLRSNNFHHHTERHYRTSSIVPFGANLAFVVYNCTVXEKEDYKIEVLVNEQP
ISLPCCAGDTKCPWEMFVHCFDDNVNSCNLESICEEPDNHHDEL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtttctttaggaacttctttccttccctgtagaaaatatcgtatttttagc
aaaaaatattggttatttttacttgtaatctttttaagcgtacatcttagctatggaagt
aaccakagattgggatttgcgtcgaaaactccatattttttcaaagaagtgcaaagcaag
tcacatctgtcagctgaatgcaaggtgattcacgttaattttcttggacgacayggaaca
cgatatcccagtcacaaagatatcaagaagataaataccatggcacttttgattaaccat
ctgcacgcatctcatggaggatttgcgtttgataaggttcaattcccttgggctagtcca
ttccaagaacatcacgacaaaagcttgacagaaagaggtgaacaagaactttatgacata
gccaaacgcatgcggcgtcgattccccgagtttttcaactctaatctaactaatgatcat
ttgaaattcgtcagtacacagacatcgcgtactttgaagagtgccatggcattttcaatt
ggtcttctggagggyactgggaaacttggcacgtgtggcatacgcccagttgatattgaa
tcaacagatatccacaatgatacaatyttgagattctttgatgtctgtcctaagtacttg
aacactgtatccaaaaataaaacatctttattcgagcatcatgactttaaacacacccag
catatgacagaggttgtcgaacatgtgcgacagcagtttggcaataaccytgccataatg
gccaagcatgtgataggcatgtttattgcatgtacatttgagtatgcagtgtttgacaga
agtgatacatggtgctcagtttttagacctgaagatataaatgtcatggagtactactac
gacctaaaacatttctggaagagaggrtgggggtacgaggtgaataccaaaatggcctgc
cctctrctttcagccatgtttacagatataaagagttttttaaacrcaagtgatgttcac
agaaaagcaggagttttccgatttgctcatggtgaaacacttcarccattgtactgctta
cttggtcttttcaaagacactgagatgctaagatccaacaattttcaccaccatacygaa
cgtcactacagaaccagcagtattgtgccttttggtgctaacttggctttcgtggtatac
aactgtactgtcrgtgaaaaagaagactacaagattgaagtacttgtgaatgagcaacct
atttctttaccatgttgtgcaggagataccaagtgtccatgggagatgtttgtacattgt
tttgatgataatgtgaacagctgcaatttagaaagtatatgtgaagagcctgacaaccat
catgatgagctgtaa

DBGET integrated database retrieval system