KEGG   Exaiptasia pallida: 110239560Help
Entry
110239560         CDS       T05080                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
epa  Exaiptasia pallida
Pathway
epa00010  Glycolysis / Gluconeogenesis
epa00562  Inositol phosphate metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110239560
   00562 Inositol phosphate metabolism
    110239560
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110239560
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110239560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110239560
NCBI-ProteinID: XP_020900939
Position
Unknown
AA seq 476 aa AA seqDB search
MAAISVGISALFLLVLLQISSTSKTPKKFLFSDKTPYHYSRKTIQKPPNCDPVHISMVIR
HGSRYPGKLQVKKMKSLLKKLNTLYPPNSTFRYKGLSLPWTIPKDVLDSESKEMSRLGSQ
EMYSIAQRFLAHFPXVLRHGYSNTNYGFVATDKLRSSQSATAFAQGLFDGKGHLGSSKYQ
PIAVKSSGEYNNDYTLRIFESCPKWQRITRKERARSEHSKFINGPEMRKVIRKISKRLKL
GKKFLLRPKMVVDIFLMCAFGVQADSADGSWCXIFEESDLKVLEYLQDLKLYWDRSYGRK
INFKMGCALYTEIINSFQRFIQKGKPHGVFRFAHTGTVIPLFTMLGLYNDTVPPRADNFV
RQKNRKFRISNVVPMGANVAFVLYTCKGKATNRSSNANSCQDHCQGKKPLVVSDLKIQLL
VNEAAVPIPACHGRTFCGLQRFLSHYAHIKDNCXIQKICRTRLKCRKGFINKGPAD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatatctgttggaatttcagcgctatttctccttgtccttttgcaaataagc
tcaacatcgaaaacgccaaaaaagttcctattcagcgacaaaacaccgtaccattacagc
cgaaaaaccatccaaaaaccacctaattgtgacccagttcacattagtatggtgatacga
cacggatctcgttatcccggaaaactacaagtcaaaaagatgaaatctttgttgaaaaag
ttaaacacactctacccacccaactcaacttttcgatacaagggcctttcactgccttgg
actataccaaaagacgtacttgactccgaaagtaaagaaatgtctagattaggttcgcag
gagatgtactcgattgctcagcgcttccttgctcattttcctkgcgtcttgaggcatggg
tattccaacacgaactacggttttgttgctaccgacaagctgaggtcgagtcaaagtgct
accgcttttgcgcaagggctttttgatggaaaaggacatcttggttcctccaaataccaa
ccaatagccgtgaaatcgtcgggggaatacaacaacgactataccttaagaatattcgag
tcttgtcccaaatggcagcgaatcactagaaaggagcgcgcacgctcagagcattcaaaa
ttcataaatggcccagaaatgcgaaaggttatacgtaaaatttctaaaagattgaaacta
ggcaagaaattccttcttcgcccaaagatggtcgtggatatcttcctcatgtgtgccttc
ggggtgcaagccgacagtgccgatgggagctggtgtragatttttgaagagagcgaccta
aaggtactggaatatcttcaagatttgaagctctactgggaccgcagctacggtcgaaag
ataaacttcaagatgggctgtgcgctatatactgagattataaatagctttcaaagattt
atccagaaagggaaaccacacggtgtttttcgatttgctcatactgggactgtgattcca
cttttcactatgcttggattatacaacgatactgtacctccccgtgcggataattttgta
aggcaaaagaaccggaagtttcgtatatctaacgtcgttccaatgggggctaatgtagcc
tttgttctgtatacatgcaaagggaaagccacgaacagaagtagtaatgctaacagttgc
caagatcattgtcaaggcaagaagcccttggttgtatctgacctaaagatccagttgcta
gtcaatgaggccgctgtacctatccctgcttgtcatgggcgcacattctgtgggctacag
cgatttttgtctcactacgctcacatcaaagataactgtaamattcagaagatatgtcga
acgaggctaaagtgtaggaaaggattcattaataagggtcctgcagattag

DBGET integrated database retrieval system