KEGG   Exaiptasia pallida: 110239648Help
Entry
110239648         CDS       T05080                                 

Definition
(RefSeq) prostatic acid phosphatase-like
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110239648
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     110239648
    3.1.3.5  5'-nucleotidase
     110239648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF3192 Ytca
Motif
Other DBs
NCBI-GeneID: 110239648
NCBI-ProteinID: XP_020901037
Position
Unknown
AA seq 453 aa AA seqDB search
MIVRVYPVLLAILVQALVTAENEFTLKQVVVISRHGSRGFLTKHHTTFKEDENSQLTVRG
MNQMLQAGQYVXHRYNGTIKNFLSAEYNSSEVYVRSSDYPRTLSSAQSFLLGLYPPRKQI
QKTYNPDKMYSAPYDVQQVPIHTXAVKNDQLLRGWLQCPTFQDKISQFYSSEMFKKKEKE
NTEFMKSLEQITGMENIALKDFYNVYDFIHLHIAYGQLYLNITDKQWSRXKDLADWLEYQ
KYNRNNIQSMGAGLLFNEIILNFGSTKKBKRKAKLLYYSAHYPTILSLFSALGVNEHDKT
LQIIPYYASLVFLELYQANTGXGEYYVKFAFRNGLQNDTGKDTFQYYVIPGCGSVMCSLD
KFVNLLKPLKVHDTKSWCSECNNVNLSTCKLGKPYNRKVAKTAVGSFFTGFFVCLILTIV
XLGVWHFCLKKRCLNRRPRHGLPDLEXRLAGAI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtaagagtataccccgttcttctcgcgatccttgtgcaggccctcgttactgca
gaaaacgaatttaccctcaagcaagttgtagttatatcccgtcatggaagtagagggttt
ttaacaaagcaccacacaacattcaaagaagatgagaatagtcaattgactgtgagaggg
atgaaccagatgctccaagcgggtcaatatgtgaakcatcgctataatggaacaataaag
aactttctaagtgctgaatacaattctagtgaagtttatgtcagatcaagtgattatcca
agaaccctttctagtgcccaaagctttctcttgggattataccctccaaggaaacagatt
cagaaaacttataatcctgataaaatgtactcagcaccatatgatgttcaacaggttcca
atccacactrttgcagtgaaaaatgaccagttactacgtggttggttgcaatgtccaacc
tttcaagacaagataagtcagttttayagcagtgaaatgttcaaaaagaaggaaaaagag
aatactgaattcatgaagtctctggaacaaatcacaggaatggaaaatattgcattgaaa
gacttctataatgtatacgatttcatccaccttcacattgcatatggtcaactgtacttg
aacatcactgataagcaatggagtcgastaaaagacctcgctgactggytrgartaccaa
aaatacaacagaaataacattcaaagtatgggagctggtcttctgtttaatgaaattatc
cttaactttggtagtacgaagaaarataaacgaaaagctaagctattatactactccgcg
cactacccgaccatcttgtctctcttttctgcacttggtgtaaatgaacacgacaaaact
ttgcaaataattccatactatgcatctctggtcttcctggaactttaccaggcaaatact
ggaartggtgaatattacgtcaagtttgcattcagaaatggtttgcagaatgacacagga
aaggatacgttccagtattacgtaattcctggatgtggatcagttatgtgttccttggac
aaattcgttaatttgttgaaacctttgaaagttcacgatacaaaatcgtggtgtagcgaa
tgtaataatgtcaatttaagcacgtgtaagcttgggaagccatacaacaggaaagtggct
aagaccgcagttggcagctttttcactggattttttgtatgcttgattttgactatagta
atkctaggygtttggcatttttgtctaaagaaaagatgtctaaatagacgaccaagacat
ggactaccggacctcgagyaccgactggcgggtgcaatttga

DBGET integrated database retrieval system