KEGG   Exaiptasia pallida: 110239739Help
Entry
110239739         CDS       T05080                                 

Definition
(RefSeq) DNA-directed RNA polymerase I subunit RPA12-like
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
epa  Exaiptasia pallida
Pathway
epa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:epa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    110239739
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:epa03021]
    110239739
Transcription machinery [BR:epa03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     110239739
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C zinc_ribbon_2 preSET_CXC DZR DUF3716 A2L_zn_ribbon RNA_POL_M_15KD Cys_rich_CPCC
Motif
Other DBs
NCBI-GeneID: 110239739
NCBI-ProteinID: XP_020901139
Position
Unknown
AA seq 120 aa AA seqDB search
MAAIKEAFECDPDFCPICGSILPLPGLEDVVSCKICDFQKDTSEFERIEIHSRKVFNEVK
EKKSNTTDEEDSIGPMVDRKCSNCGHEGMTYQTRQTRSVDEGQTVFYSCPSCKYQETEYS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatcaaagaggcatttgaatgcgatcccgatttctgcccaatttgcggttca
atattacctcttcctggattagaagacgtggtttcttgtaaaatatgtgatttccagaaa
gatacatcagaatttgagagaatagagattcactccagaaaggttttcaatgaagttaaa
gagaaaaaatccaatacaactgatgaggaagactctataggcccaatggttgatagaaag
tgttcaaactgtggacatgaaggcatgacataccaaacacgacagacacggtcggtggat
gaaggacagaccgtgttttacagctgccctagttgcaaataccaagagactgaatattca
tag

DBGET integrated database retrieval system