KEGG   Exaiptasia pallida: 110241689Help
Entry
110241689         CDS       T05080                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
epa  Exaiptasia pallida
Pathway
epa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110241689
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epa04030]
    110241689
G protein-coupled receptors [BR:epa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110241689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 110241689
NCBI-ProteinID: XP_020903237
Position
Unknown
AA seq 302 aa AA seqDB search
MSPLYIVIPLSILSIVIVLFNIAVCCLVCCNKKLRTFTNGFIVSLAISDIMVGAILFPCY
LTNPFGTAEFIGYIVSIILLAGVSNLCTVTYDRYLALSHPLTYKYRVSKIFVRAIIASWT
IPIIYSLLPLIWSTDMKLPIHKIYIIGLQVFGVMIPYILIIIAYIRIYVKVKRSLKRRRK
FSMNSLQHSKQERRRVSSEVKVAKVFSIVAASFILCWIPVIYITTADQILNKQSLIPEPL
GSVSLFTVAFSSLVNPLLYSFMKPDFYQVISKALRSCITPMGRGNEQTIALSPISVCTEN
NS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctctctatatcgtgattcctttgtcgatattgtctatcgtcattgtgttgttc
aatattgctgtttgttgccttgtgtgttgtaacaagaaactaaggacgtttacaaatggc
ttcattgtctcactggccatatctgacatcatggtaggtgcgattttatttccgtgttac
ctgactaacccatttggtacggctgaattcataggatatatagtttccattattcttctt
gctggagtatccaacctatgtacagtaacatacgatcgttatttggcattaagtcatccc
cttacatacaaatacagagtttccaagatattcgttagggctataatagcttcatggacg
atacccatcatatattcgctcttgcctttaatatggagcacagatatgaaactaccgata
cacaaaatctacatcattggcctgcaagtatttggtgttatgattccatatattcttatt
ataatagcgtatataaggatctacgtcaaggtaaagagaagtctcaaacggcgaagaaag
ttttcaatgaactcattacaacattcaaagcaagaaagacgtcgcgtgtcaagtgaggtg
aaggtcgctaaagtgttttcaattgttgctgcctcattcattttatgttggataccagtg
atttatataacaactgcagatcaaatacttaataarcaaagtcttattcctgagcctttg
ggaagcgtttcactattcacagtcgcattcagttcgttagttaatccactgttatattct
tttatgaaaccagatttctatcaagttatatctaaggctttgcgatcttgtataacacca
atgggcagaggcaacgagcaaaccattgctttatcacccataagcgtgtgtactgagaac
aattcgtga

DBGET integrated database retrieval system