KEGG   Exaiptasia pallida: 110242866Help
Entry
110242866         CDS       T05080                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
epa  Exaiptasia pallida
Pathway
epa00350  Tyrosine metabolism
epa00360  Phenylalanine metabolism
epa00380  Tryptophan metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110242866
   00360 Phenylalanine metabolism
    110242866
   00380 Tryptophan metabolism
    110242866
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epa04147]
    110242866
Enzymes [BR:epa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     110242866
    4.1.1.105  L-tryptophan decarboxylase
     110242866
Exosome [BR:epa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110242866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 110242866
NCBI-ProteinID: XP_020904571
Position
Unknown
AA seq 429 aa AA seqDB search
MDNKQFREYGKELIDFIGDYFENIEQSSIKPDVKPGFLLNKLPSSAPSQGEQFQEILADY
QEHVMPGILGWNNPNFHAYFPASISYPSILGELLAAATGGVGFEWSVNPSYTELEIVVTE
WLGKLLNLPKQFIATDPSQGQNGKWGGGVIQSTASESVVVAMLAARKRALDRLKEKSPDE
CDSVLMGKLVAYSSVVSHSSIMKAKLVCATKIHLIETDDQGVIDVELLIKTIKEDVQSGL
IPFFFADSFNLNAHKLMLTNFDCSPFWVKDRNALMNALSVEGSYFKDDDTGVVTDFRKWQ
IPLGRRFRALKLWFVLRTYGMEGVQRHVREHIERTKLFETLIAQDVRFEFWPRKPNLGLV
CFRIKGADELTKSLSENINAGGQIALSAMQFKKKIIIRFHGGLGNDSHVHNAWNVIKNET
DKLLKQNMN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaataaacaatttcgtgaatatgggaaggaattaatcgactttataggagattat
tttgagaatatcgagcagagttctatcaaacccgatgtcaagcctggatttytattgaat
aagctgccatcatcagctccaagccaaggwgaacagtttcaggagattcttgccgactac
caagagcacgtcatgccagggatcttgggctggaataacccaaattttcacgcatacttc
cctgcaagtatttcatacccttctattcttggtgaactattagcagcagctactggggga
gttggatttgagtggtcagtaaatccttcgtatacagaacttgagatcgttgtaacagaa
tggttaggcaaactcctgaatctcccaaaacagtttattgcgacagacccaagtcaaggc
caaaacggaaaatggggcggtggtgttatccagagtacggctagtgaaagtgttgtcgta
gctatgttagcagcaagaaagcgtgcccttgatcgtcttaaagagaaaagtccggatgag
tgtgattcagtgctgatgggaaaacttgtcgcatactcttcagttgtatcccattcatcc
atcatgaaagctaagcttgtatgcgctactaaaatacatctgattgaaactgatgatcaa
ggagtgatagacgttgaattgctgataaaaacaatcaaggaggatgtccaatccggtctt
attccgttttttttcgctgactcattcaatctcaacgctcataaactgatgttgacaaac
tttgattgctcaccgttctgggttaaggatcgcaatgctcttatgaacgcgttaagtgtc
gaaggttcttacttcaaggatgatgacacaggcgttgtcaccgactttaggaaatggcag
ataccgctgggtaggcgattcagggcgctaaagctatggtttgtgttacgtacttatggt
atggaaggagttcagcgtcatgtcagagagcacatcgagcgcaccaaactgtttgaaact
ttaatagctcaagacgttcgtttcgagttctggccaagaaaacctaacttgggtttggta
tgttttaggataaagggtgcagatgaactgaccaaatcattgtcagaaaacatcaacgct
ggtggacaaattgccttgtcagctatgcaatttaaaaagaaaataatcatccgtttccat
ggtggccttggcaacgatagtcacgtgcataacgcttggaatgtcatcaagaatgaaacg
gataaattattaaaacaaaatatgaattag

DBGET integrated database retrieval system