KEGG   Exaiptasia pallida: 110245036Help
Entry
110245036         CDS       T05080                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 1A-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
epa  Exaiptasia pallida
Pathway
epa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110245036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epa04030]
    110245036
G protein-coupled receptors [BR:epa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    110245036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 110245036
NCBI-ProteinID: XP_020906949
Position
Unknown
AA seq 390 aa AA seqDB search
MVDHSSNPTFPPLPPDPGGDPGQDILENVLKQLEDCGVNGTNLTSISSMNDSQRILYIGS
LLDKYNCSGAGNGPPTSIPQVGNSKIPPHVLLVIYFVTVMVLGLLVNLCVIGTITRVRRL
RTITNCFVLSLAFADLLMAAVVVPLQIKELYRPQTQSSPFIDTLFPILGVASLLNLCAVT
LDRYFTITNPLTYEAKVSSVRAGFIIASIWIIATAQGLIDLLAIPFEDQPVFQVVRFVIV
FSIPFICVIFVNTKIYCIARGHARQIRANEPGQTTSGGRSFSRKIKTAQVIGLLVGTFVL
TWLPYFILTIYEQFEEGKGNTPRALKIVKKVTEALACSTALFNPLLYGFLRKEVRIAIIR
GLKCQNVNLSDLDTTATAENTTRRLEITRK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaccattcctcgaacccaacatttcctccactgccaccagatcctggaggagac
cctggtcaagatattctagagaatgttttaaaacaattagaagattgtggagtgaacggg
acaaatttaacgtcgatttcgtccatgaatgattcgcagcggatactgtacataggaagt
cttttagataaatataattgctccggtgcgggtaatgggccaccgacatcaattccacaa
gttggtaattctaaaatcccgccacacgttctgcttgttatctatttcgttactgtaatg
gtgcttggcttgctcgttaatctatgtgttatcggaacaatcactcgagttcgaagactg
agaacaattacaaactgtttcgtactaagcttggcgtttgcagacttgttgatggctgct
gtagtcgttccattgcagattaaagagctgtaccgaccacaaactcaatcatcgccattt
atagataccctttttcccattctgggtgtcgcgtctctactaaatttgtgcgctgtgacg
ctagatcgttactttaccattacaaacccactgacttacgaagctaaagtcagttccgta
cgagcaggctttatcatcgcctctatatggatcatagccacagcgcagggattgatagat
ctacttgctatcccttttgaagatcaacctgtctttcaagtggttcgtttcgtgattgtg
tttagcattccatttatatgcgtaatctttgtgaatacgaaaatttactgtattgccaga
ggtcatgccaggcaaataagagccaacgaaccaggccaaactacttctggtggacgaagt
ttttcaagaaagataaagacagcgcaagtcattggattattagttggcacattcgtatta
acgtggctcccttacttcatactaactatctatgagcaattcgaggaaggaaaaggcaac
acacctagagccttgaagattgttaaaaaagtaactgaggcgttagcttgtagtacggca
ttgttcaacccacttctgtatggatttctgagaaaagaagtccgaatcgcaataatacgc
ggtctaaaatgtcagaacgtaaatctctcagatttggacactaccgcgacggcagagaat
acgacacgtcgactcgaaatcacacgaaagtaa

DBGET integrated database retrieval system