KEGG   Exaiptasia pallida: 110245605Help
Entry
110245605         CDS       T05080                                 

Definition
(RefSeq) tankyrase-2-like
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:epa03032]
    110245605
   03036 Chromosome and associated proteins [BR:epa03036]
    110245605
Enzymes [BR:epa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     110245605
DNA replication proteins [BR:epa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     110245605
Chromosome and associated proteins [BR:epa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     110245605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 110245605
NCBI-ProteinID: XP_020907547
Position
Unknown
AA seq 389 aa AA seqDB search
MKNQENQTPLDLASAEDVKCLLGDALLTHNSTSAASATPTKTPSPVSTAATTTGASPLST
ANSSLLASSPAGSGDGAISNRSVSEAQGQAADKHGISGHPGLDVDVGQFLDSLQLNNLKE
IFEREQISWDVLVDMGHEELKEIGIHAYGHRHKILKAVKEKLSGLGLGFGPFATTSLQGS
VLQELTPVDKDYSSVADEMQSTVVEHRDSGASGGIFSSYTIGKIERVVNTKLWDKYVYRR
REIADSNHNHSNERMLFHGSPFINAIVQKGFDERHAYIGGMFGAGIYFAENSSKSNQYVY
GIGGGQGCPQHKDRSCYSCERQLLLCRVALGKPFYQFSAVKMAHSPPGHHSVIGRPSSGG
LSFAEYVIYRGEQAYPEYLITYKINKPEA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaagaaaatcaaactcctcttgaccttgcatcggctgaagatgtcaagtgc
ttactgggcgatgcacttctcacacacaattccactagtgcagcatccgccactccaaca
aaaaccccctcacctgtctctactgccgcaacaacaactggtgcatctcccttatcgaca
gccaacagtagtctgctggccagtagtcctgcaggctcaggtgatggtgctatcagcaat
cgatctgtttcagaggcccagggacaagctgcagataaacatggaatatcaggtcaccca
ggccttgatgtcgacgttggacagttccttgacagcctacaactcaacaacttaaaagaa
attttcgaaagagaacaaatctcatgggatgtccttgtcgatatgggtcatgaggaactc
aaagaaataggaatccatgcatacgggcacagacacaagatattaaaggctgttaaagaa
aagctctctggtttaggactagggttcggaccatttgctacaacgtctctacaaggttct
gtactacaagaactgacacctgtcgacaaggattacagctctgttgcagatgagatgcaa
tcaacagtagtggaacatcgagacagtggtgcttctggtggtatcttctcgtcgtacacc
ataggcaagatcgaacgagttgtaaacactaaattatgggataaatatgtataccgtcgg
cgagagatcgccgattcaaatcataatcactccaacgaaagaatgttatttcacggttct
ccattcattaacgccattgtacaaaaaggtttcgacgagagacatgcgtacatcggtggc
atgtttggagcgggaatttacttcgctgaaaactcctctaaaagtaatcaatatgtgtat
ggaataggcggtggacagggatgtccacaacacaaagacaggtcgtgctactcgtgcgaa
aggcaattattactgtgtagagtagcacttggaaaacccttctatcaattctcggccgtc
aaaatggcgcactcgcccccaggacatcactctgtcatcggtcgcccaagctctggtgga
ctatcctttgctgaatatgtaatatatcgtggagagcaggcttatccggaataccttata
acgtacaaaattaacaagccagaagcgtaa

DBGET integrated database retrieval system