KEGG   Exaiptasia pallida: 110247205Help
Entry
110247205         CDS       T05080                                 

Definition
(RefSeq) putative tRNA pseudouridine synthase Pus10
  KO
K07583  tRNA pseudouridine synthase 10 [EC:5.4.99.25]
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:epa03016]
    110247205
Enzymes [BR:epa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     110247205
Transfer RNA biogenesis [BR:epa03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    110247205
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-4CXXC_R1
Motif
Other DBs
NCBI-GeneID: 110247205
NCBI-ProteinID: XP_020909269
Position
Unknown
AA seq 501 aa AA seqDB search
MEIESVKTAVDELHRLSLCARCILRFIDERNSSLYEGDFEAVSEYVSKXYSLDEPCFDKE
NNRKKDDLSVDDGLWSCTACLGILNCSTVKQIADAVENSEFEYGSFTLSLSIPLCCLVRQ
HSIFLYLKEKFSGIYADKKTVDSLPSIKEVFKWVCGPRLGEILGVYFQHESPFQISVQFG
HNNGNDELEFLTDFDPLQFKERKVKKRAPKPVIYSITTVKKALEELDTADKLRKFTFCPS
KVPNYKSFCTQVSCTHNSLLLAGRYNKYSRRLPQTPWLIEGERMLESSVQEKICDVIELK
IKADDYKFSSGGREDVDVCMLGTGRPFVIECINPRKTKLSREFLSDLQKEINSSSQDIAI
RDLQVVTKNDYKTLKEAENTKTKTYSCLVWTEKEITNKQLLPLHDIKDLVLKQKTPLRVL
HRRPVAVRDKVVHNMSCKWIDDHHFRLNLKTMAGTYVKEFVHGDFGRTKPNLGTLLEMQT
DILELDVQSVDVDWPPSLGQE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaagcgtgaagactgcagttgacgagctccacaggctaagtttgtgtgca
cgctgtattttgcgatttatagatgaaagaaactcttcattgtatgaaggagactttgag
gcagtttctgaatatgttagtaaaargtattctttagatgaaccatgtttcgacaaggaa
aacaacaggaaaaaagatgacctttctgtagatgatggtctgtggtcctgcacagcctgt
cttggaattcttaattgttctactgtaaaacagattgcagatgctgttgaaaattcagag
tttgaatatggaagttttactttgtctttgtctattcccttatgctgtcttgttagacag
cattcaatatttttgtatctaaaagaaaaattcagtggtatatatgcagacaagaagact
gtagattcattaccgtccatcaaagaagtttttaagtgggtgtgtggaccacgactgggt
gaaatattgggtgtctactttcaacacgagagtccattccagatttctgttcaatttgga
cacaacaatggaaatgatgaattagaatttttaacagacttcgatccactacaattcaaa
gaaagaaaggttaaaaagagagcacccaaaccagtgatctactcaataacaacagtcaag
aaagcactagaggaacttgacacagcagacaagcttagaaagtttacattctgtccctcc
aaggtaccaaactacaaaagtttctgtactcaagtatcttgtactcacaattcattgtta
ttggcaggtcggtataacaaatactcaagacgtctaccacagactccatggttgattgaa
ggggagcgcatgcttgaatcttcagtacaggaaaagatatgtgatgttattgaattaaag
atcaaagcagatgactataaattttcatctggtggaagagaagatgttgatgtctgtatg
ttaggcacaggtcggccatttgtaatagagtgcataaatcctcgtaaaacaaagttaagc
cgtgagtttttgtctgacttgcaaaaagaaattaactcttcatcacaagatattgcaata
agagatttacaagttgttacaaaaaatgattataaaacgctgaaggaagcagaaaacaca
aagactaaaacatacagctgcctggtttggacagaaaaagagattactaataagcagttg
ctgccattacatgatatcaaggatttagtgttaaaacagaaaacccccctaagagtttta
cacaggagacctgtggctgtccgtgacaaagttgttcataacatgagttgcaaatggata
gatgaccatcactttagattgaatctcaagacaatggctggaacatatgtcaaagagttt
gtacatggtgattttggacgcactaagcccaacctaggaacattgttggaaatgcagaca
gacattttagaacttgacgtacagtcagttgatgtggactggcctccatctcttggtcag
gaatga

DBGET integrated database retrieval system