KEGG   Exaiptasia pallida: 110248871Help
Entry
110248871         CDS       T05080                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:epa04131]
    110248871
Membrane trafficking [BR:epa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    110248871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DUF3398 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 110248871
NCBI-ProteinID: XP_020911086
Position
Unknown
AA seq 1933 aa AA seqDB search
MAASPGGSVTSTRAFAQKLNKNQGAAEVRRNVSTVFVSQSSKRSSTASSFIHLASGTVPL
TEVVDPLDFEDFILQSQPLNDNEPESSMLEFPDDDIEVTTIPRHCRTVQPSIPKDIGFDS
DPHLKDCVHTYTADWSIVNRRYQFRCSEESKPDSRRKITHSRSFTDSLPRHLYEVDEKHK
SADQDKEDNTGQESKPLNDLPKGSWASSIFDLQSSQPDDLLPTLLDRVPPEQVDETNEVQ
RKLHRVDSCFSVYPVQQEEGIERRVPATIPQEHFGQRVLVKCLTLKFEIEVEPFFASMAL
YDLRVKKKISENFYFDMNPEWCRKLLKDTTPRTDISTLSRSAIFSITYPSTDVFLVIKLE
KILQQGDVSEIAEPYMKDTESPKQKEKVRSSVMNSVDRLGKYRMPFAWTAIHLIDIISGA
ASAETGGTNEKEVTTGGTPGSRKVSNEPSAAAKPSRKVDSFPRSVSVQDQRKSFYGSYMS
EGTEFEQLPDLTKFRPVTLTVSSFFKQESDKLKDEDLYKFLADIKRPSSVLKRLKTIPGT
LKLDISPPGDKPPYCLTSELQQVIPYPDGQGRPTKEIEDGRLALGEFHLPVSVDKPPQGY
SVLSPEVQLPGMKWVEGHKGVFHVAVRAVSSVHTQDHHIHKFLKMCHQIEGRLSSPSRNT
DSNVEMVLRKSIVDLVKSREEPLVRYLHLILDKLILLLVRPPVISGTVVNIGQAAFESLA
QIVRRLHELLEFNQDEHNRNNLLCSYVTYVFSAPYTPSPTSTPIFPGDGSRPVSMTSGSS
LIPPMHSKSSLSNSNPQLNASSQGDGQAGHXQNWENDKAKAGVEMAGNRNSMAEPRLGAM
NIPGLPASNKKSVHEELALQWAVASTPVREVAMKHSWFFFELMVKSMAQHLDNTDRFFLP
RKARFPEQFLDDVRALVNTTIAEIVSKNKDFTFAQDLNSSLGFFLYDLLSLVDRGFVFDL
IKHYCKEMLYQGGLHAGLAQLRLELLRIVSSHEHFVTLNLPFPTDLYPSEPSSPTSSMSS
LTSGGTLTPANSMAELSVAFRQQHFLVGLSLAELTLSLESADFALQCQAIDCIRDLLACH
DSDTRYDDPVCRSRVAALYLPLMGIVIDSLPQLHGYRAEEAEGLNPDVAMAIATSSIASR
YDTRPELASQLSKPQPLTQESTRNLLMGFLWVLKNMDPAVLRXWWSDQEPPRLGLLLDVL
HMCITQFEYNGKKEVREKRNVTAPRSNRTVTDKKKLEEMLLGQSGAAAEMKQRHSRNISQ
SQGNIEPKLRWRKDMTQWRQAIDMQEKVCPEVAISSKIEGMMCAEVNIIVLDTLELIVQF
PELLFEEETELCADLCSRLLTHCSSSIGNVRSQASASLYLLMRQNFEQNRGVNFARVKMQ
VTMSLSTLVGTSHAFSEECLRRSLKTIITYAESDFELKNTTFPEQVRELVFNLHMILTDT
VKMKEFQEDPEMLIDLMYRIAKGYQNSPDLRLTWLNNMASKHAELNNKVEAALCVVHAAG
LVAEYLTMIEDKRYLPVGCVAFEKISPNVLEESAVSDDVVSPDEEGICTGKYFSENGLIG
LLDTAASTFDSAQVFECVNEVFKLLIPILEARRDYMKLASVHSKLSEAFTRIKQTEGKRM
MGTYFRVGFYGSKFGDLDGEEYVYKEPAITKLPEISHRLQRFYGEKFGQDNFEVIKDSDA
VEREKLDPNKAYVQLTYVEPYFDEYEMKDRITYFDKNYNLRRFMYVTPFTPSGKKRGDLA
NQYKRKTTLTVANSFPYVKTRISVIHREQIVLSPIEVAIEDMQMRSNELVNAIKQKPPDA
KMLQMVLQGSIGTTVNQGPLEIANVFLYAEEDGDEDQDIQPLDCSRHHHKLRLAFKEFMK
RCGDALHLNKSLIKTDQRAYQKELERNYHQLVNQLEPFLKNRFGTLRGSIRKKEGSALLR
KISMSFNAQHSVA
NT seq 5802 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccccaggtggaagtgtaacttctactcgagcctttgcacaaaaactgaac
aaaaatcagggggcagctgaagtccggcgtaatgtctcgactgtgttcgttagtcaatca
agtaagcgctcgtcaactgcctcgtcttttattcatctcgccagcgggacggttccctta
acagaagtagttgatcctttggattttgaggacttcattctccagagtcaaccactaaat
gacaatgagccagaaagtagtatgctggagtttccggatgatgacattgaagttactaca
ataccacgacactgtagaacagttcagccttctatacctaaggatattgggtttgatagt
gaccctcatttaaaggattgtgttcatacctatacagcagactggtctattgtcaacaga
aggtaccagtttaggtgtagcgaggaaagtaaacctgactcgcgtcgcaagatcacacat
tccagaagctttacagactctttaccaagacatttgtatgaagtggatgagaaacataag
tctgctgaccaggacaaggaagataacacaggtcaagagagtaaaccattgaatgattta
ccaaaaggaagctgggcttcaagtatttttgatttacaatcatcacaaccagatgatctc
ctcccaacactactggacagagtaccacctgaacaggttgatgagacaaatgaagttcag
cgcaagttgcatcgtgttgattcttgctttagtgtttatccagttcagcaggaagaagga
attgaaaggagagttccrgctaccattccacaagaacactttgggcaaagagtacttgtg
aagtgcctcactttgaagtttgaaatcgaggtagaaccattctttgcaagtatggctctg
tatgatcttcgtgtgaagaaaaagatttcagaaaayttctactttgacatgaaccctgaa
tggtgycgtaaacttttaaaagacacaacaccaaggacagacatctctacactgagtcgt
tctgcaattttctccattacttacccctcaactgatgtgttcttagtcatcaaactagag
aaaatcttacaacaaggcgatgttagtgaaatagccgagccatacatgaaagacactgaa
agccctaagcaaaaagagaaagtccgttcatcagtaatgaacagtgttgatagacttggc
aagtacagaatgccatttgcttggacagctattcatctgattgacatcatcagtggtgct
gcttctgctgaaacgggrggcactaatgaaaaggaagtgacaacaggggggacacctggt
agtcgaaaggtcagcaatgaaccatcagctgctgcaaaacccagtagaaaagtagacagt
tttccaagatcagtctcagtccaagaccaaaggaagtccttttatggtagttacatgagt
gagggaactgaatttgaacaattgcctgacctcacaaagtttaggccagttactttgact
gttagcagctttttcaaacaggaatctgacaagctcaaagatgaggatctgtacaagttt
ctagctgatattaagagaccatcatcggttcttaagcgcttgaaaactatcccaggtaca
ctcaagttagatatctcacctcctggagacaaaccaccatactgcttgacktcagaacta
caacaggttattccttatcctgatggccaaggaagaccaacaaaagaaattgaggatggc
cgtctggcccttggtgagtttcatcttccagtatckgtagacaagcctccccagggatac
agcgttctttctccagaggtacaattgccaggtatgaagtgggttgaaggtcataaaggg
gtgtttcatgttgcagtacgagctgtgtcttcagttcatacacaggaccatcatattcat
aagttccttaagatgtgccatcagattgaaggacggttgtcttctccatcaagaaacack
gacagtaatgttgaaatggtgcttcgtaaaagtattgttgacttggtaaagtcacgtgaa
gagccccttgttcgctatcttcaccttatactggataagcttatccttcttcttgttcgt
cctcctgtcatctctgggactgttgtgaacattggtcaagcagcatttgaatcactggca
cagattgtccgtcgactgcatgaattgttagagttcaaccaagatgagcacaaccgaaac
aatytgctatgttcctatgttacgtatgtgttttctgcaccgtacactccatcaccaaca
tcaactccaatctttcctggtgatggtagtcgtcctgtaagtatgaccagtgggtcttca
ttaattcctccaatgcactctaaatccagcctcagtaacagcaacccacagcttaacgca
agcagtcagggggatggtcaggcaggtcacrcacaaaactgggagaacgacaaggcaaag
gcaggtgtagaaatggctggtaatagaaacagcatggctgagccacgcttgggagctatg
aayatacccggtcttcctgcaagcaacaaaaagagtgttcatgaagagcttgctttacag
tgggctgtcgctagcacaccagtccgagaggttgccatgaaacattcttggtttttcttt
gaacttatggtaaagagcatggctcaacatctcgacaatacagaccgcttctttcttcca
cgcaaagctcgtttcccagagcagtttctagacgatgtacgtgcccttgtcaataccacc
attgcagagatygtcagcaaaaacaaagactttacctttgcacaagatttgaactcaagt
cttgggtttttcttrtacgatttgttgtcactcgtcgaccgtggatttgtttttgacttg
ataaagcattactgtaaagagatgctctatcaaggtgggctccatgctggacttgcgcag
ctacgactggarctactgcgcatagtcagtagccacgagcactttgtgacgttgaacctt
cctttcccgactgacctgtacccctcagaaccatcgtcccccacatcatccatgtcatct
ctaacatcagggggaacattaacaccagcaaatagcatggcagagttatcagtggctttt
aggcaacaacatttccttgttggactgtctctagctgaattgactctctcactggaaagc
gctgatttcgcgttacagtgccaagccattgactgtattagggatttactagcatgtcay
gattcagacacacgatacgacgacccagtctgccgtagccgggttgcagccctatacctc
cccctgatgggaattgttatagactcgctgcctcagctccatggttacagggctgaagaa
gctgaagggcttaacccagatgttgctatggcaatagctacatcaagtatagcttcgcga
tacgatacacggcctgaacttgcttcacagctctccaagccacaaccgctgacacaggag
tcgactcgtaatcttttgatgggtttcctgtgggtgctaaaaaacatggatcctgcagtg
ttgaggmtgtggtggtctgatcaggagcctccaaggctgggcttactactagatgtccta
cacatgtgtatcactcaatttgaatacaacggaaagaaagaagttcgagaaaaaaggaat
gtcactgctcctcgaagcaataggactgtcaccgataaaaagaaactagaggaaatgctt
cttggacaatcaggagctgccgctgaaatgaagcagagacattcacgtaacatcagtcaa
tctcaaggaaatatcgaacccaaattgcgatggcgcaaagatatgacccaatggagacaa
gcaattgacatgcaagaaaaagtctgcccagaagttgccatttcatccaaaattgaaggc
atgatgtgcgctgaagtgaacattatagttttggacacactggaattaattgtacagttt
cctgagctgttgtttgaagaagagacagaattatgtgcagatctttgctctcgtctgctt
acgcattgcagctcatcgattgggaatgttcgttcccaggccagcgcatcgctctatctt
ttaatgaggcaaaactttgaacagaacagaggagtgaattttgctcgtgtcaagatgcaa
gttacaatgtcactatcaacccttgtaggaacatctcatgcgtttagcgaagagtgtctg
agaagatccttaaagaccatcatcacttatgcagaatcagattttgaacttaagaataca
acttttcctgaacaggtccgtgaattggtgtttaatcttcatatgattctcactgataca
gtcaaaatgaaagaattccaagaggatccagagatgttgattgatttgatgtacagaatt
gccaaaggatatcagaattcacctgatttgagactgacatggctgaacaacatggcgtcg
aagcatgccgagttgaacaacaaagtcgaggcagcattgtgcgttgtacatgctgcaggc
ctggtcgctgagtaccttactatgattgaagacaagcgytatttaccagttgggtgcgtt
gcctttgaaaagatatcacccaacgtactagaagaaagtgctgtttctgacgatgttgta
tctccggacgaggaaggcatatgtactggtaaatatttcagtgagaatggattaattggt
cttttggacactgctgccagtacatttgacagtgcrcaggtctttgaatgtgtcaacgag
gtgtttaaattgctaattcccatattggaggctcgacgagactatatgaagcttgctagt
gtgcacagtaagctgagtgaagcgtttacaaggataaaacaaaccgaaggtaagcgtatg
atggggacctatttccgtgtgggtttctacgggtcgaagtttggtgatttagacggagaa
gaatacgtttacaaagaaccagcgataaccaaactacctgagatatctcacagactacag
cgtttctatggcgaaaagttcggacaagataacttcgaggtcatcaaagactcagacgct
gtcgaacgcgaraaactggacccaaataaagcgtacgtgcagcttacgtacgtagagccg
tactttgatgaatatgaaatgaaagacagaattacgtatttcgacaaaaactacaatcta
cgtcgatttatgtatgtgacaccattcactcccagtgggaaaaaacgtggtgatttagct
aaccagtacaagcgaaagacgacgctcaccgtagcgaactcgttcccttacgttaaaaca
agaataagtgttatacatcgagagcaaatagtgttaagtccaattgaagttgctatcgaa
gacatgcagatgagaagcaacgaacttgttaacgccataaagcaaaagccaccagatgcc
aagatgttacaaatggttcttcagggatcgataggaactactgtcaatcaggggccacta
gagattgccaacgtctttctgtacgcggaggaagatggcgacgaagaccaagatattcaa
ccacttgactgtagtcgacatcaccacaaattaagattagcttttaaagaattcatgaaa
agatgcggcgatgcacttcatctgaacaaatctctcattaaaactgaccagcgagcttac
caaaaagaactagagagaaattatcatcagctcgtaaaccaactagaaccatttttgaag
aacaggtttgggacgctgcgtggatcgatcagaaaaaaggaaggwtctgctcttctgaga
aagatttccatgagttttaatgcacagcacagcgtcgcgtaa

DBGET integrated database retrieval system