KEGG   Exaiptasia pallida: 110250014Help
Entry
110250014         CDS       T05080                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
epa  Exaiptasia pallida
Pathway
epa00564  Glycerophospholipid metabolism
epa00565  Ether lipid metabolism
epa00590  Arachidonic acid metabolism
epa00591  Linoleic acid metabolism
epa00592  alpha-Linolenic acid metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110250014
   00565 Ether lipid metabolism
    110250014
   00590 Arachidonic acid metabolism
    110250014
   00591 Linoleic acid metabolism
    110250014
   00592 alpha-Linolenic acid metabolism
    110250014
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     110250014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 110250014
NCBI-ProteinID: XP_020912270
Position
Unknown
AA seq 717 aa AA seqDB search
MSTLQASYKTCLSFEITVLRGRDISKGKVADYIDTPDPYVRLRIPSAPSGKAQTKVVNNS
KNPEWNETFTFYLDPNKENVLEITLMESDLVSDDVLDTHTFRINDLEIBVLCEQTFKFGE
TSKVDVEMKLSKCPDSGDLRFSQELCEEEIEFLTKRKEKVLEVLQELLGDKGPTNVSEVP
TIALLGSGGGFRAMTSMSGVLCALTDTKLLDCITYFAGLSGSAWYLSCLYSHPDWPTVHP
RVILEELRENLKENMIWQLVKPKWVYKHMQLINKKKKNGQPVSFTDVFGYLVGETIIKGR
QPPKLSNQKDKLNYATVPFPLYTCVNVKKDVSAHAFCEWLEFSPYETGFPKYGTFMKTEL
FGCKFFSGRVLKKFDEPELSYLQGIWGSAFTILLQQVVREGLKEPEEVVTDVENRGEVRK
QMEDMVASEEIDKYNKSSDDSDEDSTHDQKNGHNGEEKEDAGPVESEEGATDADKFVDIV
DKVINKFEVFRTRQGRAGLVHNFLRGLEISEADQVDNVESELVTETKRIFLVDSGLVLNS
PYPVLLRPQRGVDLFLSFDFSARDKDDEEPFKELLLSEEWARKNNYPFPPINALEQLEKD
GPKECYVFKHPTDPSCPVVIHFVLINKTFKEYSKPGVQRTDDEISAGDFSIFEDPKKHYS
TFNFHYPNEAFDRLTQLTEFNTLLYEQLMKDVISECIQRKRDGQIQAKPKKDKCTIL
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgtctacattacaggcatcttacaagacctgtttgtctttcgaaatcaccgtacttcgt
ggaagggacatcagcaaaggaaaagttgccgattatattgacacaccggatccttacgta
cgtctgcgtattccgtcagcacctagcggtaaagcgcaaacgaaagtcgtcaacaacagc
aagaaccctgaatggaatgaaacgtttacgttctatcttgatcctaacaaagaaaatgtt
ttagagataaccctyatggaatcagaccttgtcagcgacgatgttctagatacacataca
tttaggatcaacgatttggagatcratgttctttgcgaacagacgttcaagtttggagag
acttctaaagttgacgttgaaatgaaacttagtaaatgccctgattctggtgatcttaga
ttcagtcaggagctatgcgaggaggaaatagagttcttaacaaagaggaaagaaaaagta
cttgaagtgttgcaggagttgttaggagacaaaggtccaacaaatgtttcagaggttcct
actatagcgttactaggatcagggggaggttttcgagctatgacgtcaatgagtggagta
ctttgcgcattgactgatacaaagctacttgattgcataacatacttcgctggattatca
ggatcagcttggtacctctcttgcctttattcgcatcccgactggcctacagtacatcca
cgagttatcttggaagagcttcgagagaatctcaaagaaaatatgatctggcaactcgtg
aagccgaagtgggtttacaaacatatgcaattgataaacaagaagaagaagaatggacag
cccgtcagctttaccgacgtgtttggttaccttgtgggagagactattatcaaagggcgt
caaccaccaaagctgagcaatcaaaaagacaagctaaattacgctaccgtcccgtttcca
ctttacacttgcgtaaacgtaaagaaagacgtatcggctcatgcgttttgtgaatggctt
gaattttcaccgtatgaaactggtttccctaaatatggtacgttcatgaagacggagctg
tttggctgcaaatttttcagtgggcgagtattgaagaaatttgatgagcctgaattgtcg
tatttacaaggcatctggggaagcgcgtttaccattttacttcagcaagtcgtacgtgaa
ggtctgaaagaaccagaagaagtcgtcacggatgtcgagaacagaggagaagtacgtaag
caaatggaggatatggttgcctcagaagagattgataaatacaacaagagcagtgacgat
agtgatgaagattccacgcacgaccagaagaatggccataatggcgaggagaaagaagac
gcaggtcctgttgagtcggaagaaggtgctacagatgctgacaagtttgtggacattgta
gataaagttatcaacaagttcgaggttttccgcacgaggcagggacgagcaggattggtg
cacaactttttacgagggctagagatatccgaagctgatcaagtcgacaatgtagagagc
gaactagtcaccgagaccaagaggatatttctggtcgatagtggcctggtgctcaattcc
ccatatccagttctactacggccacagaggggggtagatttatttctatcctttgacttt
agcgcacgtgataaggacgatgaagagccttttaaggagttgcttctgtctgaggaatgg
gcgagaaagaacaattatccattcccaccaatcaacgccttagagcagcttgaaaaagac
ggccccaaggaatgctatgtgttcaaacatcccacggatccttcatgtcctgtcgttatt
cactttgttctaataaacaagacgtttaaagaatacagcaaaccaggcgtccaaaggaca
gacgatgaaatatcagcaggcgatttctcaatcttcgaggatcccaagaarcactacagt
acttttaacttccattatcctaacgaagcatttgacagactcactcagttaacagaattc
aacactctactgtacgaacaacttatgaaagatgtcattagtgaatgtatacaacgaaag
agagatggtcaaatacaagcgaaacccaagaaagataaatgtacaattctttag

DBGET integrated database retrieval system