KEGG   Exaiptasia pallida: 110250062Help
Entry
110250062         CDS       T05080                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV-like
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110250062
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110250062
Protein kinases [BR:epa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   110250062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg Arm-DNA-bind_4
Motif
Other DBs
NCBI-GeneID: 110250062
NCBI-ProteinID: XP_020912319
Position
Unknown
AA seq 318 aa AA seqDB search
MTDLFSCSRKEPIEDFYTIGRELGRGASSVVKFCEQKGTKNSYAVKVMKKNVDRKIINTE
IGILLRLKHPNIIQLKEIFESKTQLFMVLELVTGGELFERVVERGFYSEKDAAEAVRQIV
EAVAYLHSNDIIHRDLKPENLLYADTTDSCPLKIADFGLSKMLLGDFGTSTVCGTPGYCA
PEVLLGKKYDTMVDMWAVGVIAYILLCGFEPFFDDRGDQAMFQRILKCDYEFMTPWWDEV
SDSAKDLVSKLIVLDPSKRLSAKQALQHPWVKGDNAKREDMEKAREKLKEFNAKRKLKGG
MIGVMAVAGKGLKKQPTQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgactgatctatttagctgctcgagaaaagaacccatcgaagatttttacaccatagga
agagaactaggacgtggggcttcttcggtggtgaagttttgcgagcaaaagggcacaaag
aacagctatgcagtcaaagtcatgaaaaagaacgtggacagaaagattattaacacagaa
attggaattcttctaagactcaaacatcctaatattattcaactaaaggaaatctttgag
tctaagacacagttgttcatggtgcttgagttggttactggtggtgaactttttgaaagg
gttgtggaaagaggattttacagtgaaaaagatgctgccgaagcagtcagacaaatcgtg
gaagcagttgcatatctacacagtaatgatataattcatagggacttgaagccggaaaat
cttctctaygccgacacaaccgactcttgtccgttgaaaatagccgacttcggtctctca
aaaatgctccttggcgactttggaacgagcactgtttgtggaacaccgggatattgtgcg
cccgaagttctccttgggaaaaagtatgataccatggtagatatgtgggcagtgggtgtc
atagcatatattctactttgtggatttgaaccgttcttcgatgaccgtggtgatcaagca
atgtttcaaagaattctcaagtgtgattatgagttcatgactccatggtgggatgaagta
tctgatagtgctaaggacctagtatcaaaactgattgttctagatcccagcaagcgtctt
tcggctaagcaagctcttcaacatccttgggttaagggagacaacgccaaacgagaagac
atggaaaaagcacgcgaaaagttaaaggaattcaatgcaaagagaaaactaaagggaggr
atgataggtgtaatggctgtagccggtaaaggtcttaaaaagcaaccaacacaatag

DBGET integrated database retrieval system