KEGG   Exaiptasia pallida: 110252103Help
Entry
110252103         CDS       T05080                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
epa  Exaiptasia pallida
Pathway
epa00010  Glycolysis / Gluconeogenesis
epa00562  Inositol phosphate metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110252103
   00562 Inositol phosphate metabolism
    110252103
Enzymes [BR:epa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     110252103
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     110252103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 110252103
NCBI-ProteinID: XP_020914525
Position
Unknown
AA seq 466 aa AA seqDB search
MFKMSALLRRNIIALXVALLANLAFSMAWYPYGTNTPYQPGNLKAINTPVGCTVVHLDMV
LRHGSRYPCSHYKEPLANVVEEVNKVHKSKAFTFKNLTIPWKLPDEYQFAGDCEQGEPGN
KEIYQLGKRFRSKYNTLFNKKKYWNAHYRFEASDTPRSYKSAVAFSMGLFDGNGTLDGGK
YQPIAVKVTGPKTKDKKLRFFSSCARYIQEINNGPGLDEWKKFAKGXEIKQVISNVNKRL
NLGXKIPLDADFVYYMFWFCAYATMNNLKRDWCXLFDEEDLNVMXYYDDLWGYYSSSYGN
XIGYKTNCPLMSDIVDSLDNFISNKDGHPYGTFRFTHISTILALQTLFGMYNSTVPLRAD
NYAQNANRXFRTSKIVPMSASLALVVYRCGKDYKVQALMNENSALLPCCSPDGNSSRPCS
LEKFMSCYKHIGKSCNFEALCAVSAGSHLCQCEWMILLLILVRFII
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagatgtccgctttacttcgaaggaatataattgccctartagtagcgcttttg
gctaacctcgcattcagtatggcatggtacccttacggtacyaacactccgtaccaacca
ggcaatctaaaagccattaatacaccagttggctgcactgtcgtccatttggatatggtt
ctgcgccatggttcacgatatccgtgcagccactacaaagaaccgttggccaacgtagta
gaagaggtcaataaagtgcataaatccaaggcttttacgttcaagaatctgacaattcca
tggaarctaccggacgagtatcaatttgcaggtgactgcgaacagggagagcctgggaac
aaagaaatataccaactggggaagcgttttaggtctaaatacaataccctcttcaacaaa
aagaaatattggaacgcccattatagatttgaagcatccgatacaccacggtcatacaag
agtgccgtagcgttcagtatgggtctttttgatggtaatggcacgttagatggtggtaaa
tatcaacctatagcagttaaggttactgggccaaaaaccaaagacaaaaaacttcgtttt
ttcagctcatgtgcaaggtacatacaggaaataaacaatggacctggactagacgaatgg
aagaaatttgccaagggctycgaaataaagcaggtcatttccaacgtcaataaacgactg
aatctcggcrgtaaaattcctttagacgcagatttcgtttactacatgttctggttctgt
gcgtatgccacaatgaayaacttaaaacgtgactggtgckctctgtttgacgaggaggac
ttgaatgttatggastactacgacgacctctggggstactatagctcgtcatatggaaac
graatcggttacaagactaattgccccctcatgtcagacattgtggactccctggataac
ttcataagcaacaaagacggccatccgtatggaacctttaggtttacccatattagtaca
atattggctctgcagacactctttggcatgtataattcaactgtgccgttgagagctgat
aactacgcccagaatgcaaatcgaryctttcgtacatcaaagatagtgcccatgtctgct
agcctcgctcttgtggtgtatcgttgtggcaaggattataaagtacaggctttgatgaac
gagaattcagctttactgccatgttgcagccccgatgggaacagctcaagaccttgcagc
ttagaaaagtttatgtcstgttataaacacattggaaaaagctgtaacttcgaagcatta
tgtgctgtctctgctggttcacacctttgccagtgtgaatggatgattctgctcttgata
ctagttagatttattatatag

DBGET integrated database retrieval system