KEGG   Exaiptasia pallida: 110253348Help
Entry
110253348         CDS       T05080                                 

Definition
(RefSeq) proline dehydrogenase 1, mitochondrial-like
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
epa  Exaiptasia pallida
Pathway
epa00330  Arginine and proline metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    110253348
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     110253348
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 110253348
NCBI-ProteinID: XP_020915908
Position
Unknown
AA seq 484 aa AA seqDB search
MARIVYFQRTICRMRTYPIVQSGRQLSSLQTKTLRENNDGIEFDTTHRFFQSKKLSEIFR
SLAILKLSSYDTIVNNSLPLMNFAERVLGKTXFEKLMKKTMYIQFVAGEEYDDIQERIAH
LQENGIGTILCVPAEEDFIEDTDLFDSKEPLFDRNTAALHECIDKTASGAFAQMRVSVLC
SPSLLTYLTSLLKPYETEIEKPDGLDIKNLXRGFDTDKYHLDLVPSLSPNKNRHLQNSLR
RMDXLAEHSKRRNVRLLFDAEHTYMEGAIHQMSLTLQSKYNRKXPWVYQTYQAYRKDTVD
RLRADLQLMSNEGFHFASKLVRGAYKDSERKRAQDLGYEDPIHNTYQNTCDAYNECLEMI
LDKVAHTPAKIMVATHNEDSIILATNRMAELGIDKREGKVSFAQXYGMADQISYLLGSKG
YEIYKSVPYGPVSSTLAYLARRAAENXDVVKRTXKERSLMWKELRYRLYSTQKEAHYKLS
QERK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctagaattgtctatttccagaggacaatttgtcgtatgagaacttatcctattgtc
caaagtggacgtcaactatcaagtttacaaaccaaaacattgcgtgaaaataatgatggc
attgaattcgacacgacgcatcgatttttccagtccaagaaactcagtgaaatatttcgc
tcattggcgattctaaagctttcttcttacgacacaattgtcaataacagtttaccgttg
atgaattttgcagaaagagtccttggtaaaacaatktttgaaaagctgatgaagaagacc
atgtacattcaatttgttgctggtgaagagtacgatgatattcaagaaagaattgctcac
ttacaagaaaatggaataggaacgatcctttgtgtaccagcagaagaggattttattgaa
gacacagatttatttgacagcaaagaaccactttttgacaggaatactgcagctttacat
gagtgcatagacaaaacagctagtggagcttttgctcaaatgagagtttctgtactgtgc
agtccttcacttttgacatacttaactagcctactgaagccttatgagacagaaattgaa
aaaccagatggtctagacataaaaaatctgrccagaggatttgatactgataaatatcat
ttagatttagtacctagtctctctcctaacaaaaacagacatcttcaaaattctctgcgt
cgaatggatgscttggcagagcacagcaaaagaagaaatgtccgtctactgtttgatgcc
gagcacacttacatggagggcgcaatacatcaaatgtctcttacacttcaaagcaaatac
aacagaaaartaccatgggtgtaccaaacatatcaggcctacagaaaagacactgtagac
agactaagagctgacttgcagctgatgtcaaatgaaggatttcactttgcatcaaagctt
gtcagaggtgcttataaagactctgaaaggaagagagcacaagacctyggataygaggat
cctattcacaacacttaccaaaacacatgtgatgcatacaatgagtgtctagaaatgatc
ttagataaagttgcccacacwccagcaaagataatggtagcaactcataatgaagattct
ataattttagcaacgaacaggatggccgagttaggaattgacaaaagagaaggaaaagtg
tcatttgcacagrtttatggaatggctgaccaaatatcatacttattaggttcaaaggga
tatgaaatctacaagtctgttccttatggaccagtcagtagcacgcttgcctatttagca
cgacgtgcagcagaaaataragatgtcgttaaaagaackmaaaaagaaaggtctttgatg
tggaaggagcttagatacagactgtattccacacagaaagaagctcactacaaactttca
caagaaaggaaataa

DBGET integrated database retrieval system