KEGG   Exaiptasia pallida: 110254734Help
Entry
110254734         CDS       T05080                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
epa  Exaiptasia pallida
Pathway
epa03040  Spliceosome
epa04141  Protein processing in endoplasmic reticulum
epa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:epa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    110254734
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110254734
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110254734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epa01009]
    110254734
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:epa03041]
    110254734
   03009 Ribosome biogenesis [BR:epa03009]
    110254734
   03110 Chaperones and folding catalysts [BR:epa03110]
    110254734
   04131 Membrane trafficking [BR:epa04131]
    110254734
   03051 Proteasome [BR:epa03051]
    110254734
   03029 Mitochondrial biogenesis [BR:epa03029]
    110254734
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epa04147]
    110254734
Protein phosphatases and associated proteins [BR:epa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     110254734
Spliceosome [BR:epa03041]
 Complex B
  Other components
   Prp19 complex
    110254734
 Complex C
   Prp19-CDC5 complex
    110254734
Ribosome biogenesis [BR:epa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    110254734
Chaperones and folding catalysts [BR:epa03110]
 Heat shock proteins
  HSP70 / DNAK
   110254734
Membrane trafficking [BR:epa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    110254734
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    110254734
Proteasome [BR:epa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    110254734
Mitochondrial biogenesis [BR:epa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    110254734
Exosome [BR:epa04147]
 Exosomal proteins
  Proteins found in most exosomes
   110254734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FtsA FGGY_C DDR Radial_spoke_3 CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 110254734
NCBI-ProteinID: XP_020917426
Position
Unknown
AA seq 649 aa AA seqDB search
MAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDSERLVGDPAKNQVA
MNPMNSVFDAKRLIGRRYDESSVQLDMKHWPFKVINVGGRPKIEVEYKSEKKNFFAEEIS
SMVLNKMRETAEAYLGKKITDAVITVPAYFNDSQRQATKDAGVIAGINVMRIINEPTAAA
IAYGLDKKVGAERNVLIYDLGGGTFDVSVLAIEDGIFEVKSTSGNTHLGGEDFDNNVVDH
FIELFKRKHKKDMSTNKRAVRRLRTSCERAKRTLSSSSEAYIEIDSLFEGIDFSEKLTKA
RFEDLNKKEFRSTIEPVDKALRDAGLGKNEIHEIVLVGGSTRIPKIQEILSDHFNKKELN
KSINPDEAVAYGAAVQAAILHGDKDETVQDLLLLDVAPLSLGLETAGGVMTSIIKRNTTI
PTKQNQIFTTYSDNQPGVLIQVYEGERALTKENNLLGKFELTGIPPAPRGVPQIDVTFDV
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKDEDEKIKEKIQAKN
SLESYAYNMKQTIEDDKVKDKIPEDERQKVIDKCKEVIDWLDVNQSADKSEYDAKQKEIE
QVCSPVITKLYQGAGGAAGAPPGGFPGAPGGDAAPGGGGSSGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgcctgctgttggtattgatcttggtactacgtactcttgtgtcggtgta
tttcaacacggtaaagtagaaatcatcgccaacgatcaaggaaaccgaactactccaagt
tatgtcgccttcacggactctgagcgtttggtgggcgatcctgctaaaaaccaagtcgct
atgaaccctatgaattcggtgtttgatgccaagcggttgattgggcgtcgctacgatgag
tcctcagttcaattggatatgaaacattggccattcaaggtcataaatgttggaggtcgt
cctaaaattgaggtcgaatataagtcagagaaaaagaatttctttgctgaagagatctct
tctatggtactaaacaaaatgagggagactgctgaggcctatcttggtaagaaaataact
gatgcagtcatcacagttccagcttacttcaacgattctcagcgtcaggccacaaaggat
gctggtgttattgctgggatcaatgtaatgcgaatcatcaatgagcctacagcagctgcc
attgcatatggattagataaaaaagttggtgccgaaagaaacgtcctcatctatgatctt
ggtggtggaacctttgatgtctctgttcttgccattgaggatggtatctttgaggtcaag
tcaacttctggtaacactcatttgggtggagaggactttgataacaacgttgttgatcac
ttcattgagctcttcaagagaaagcacaagaaagacatgagcaccaacaaacgagctgta
aggagactcaggacatcatgtgagagagccaagcgtaccctgtcctcaagttctgaagca
tacattgaaattgattccttatttgagggaattgatttctctgaaaaactcactaaggca
agatttgaagatcttaacaaaaaagaattcagatcaactattgaacctgttgacaaggcc
cttcgtgatgctggactcggtaaaaatgaaatccatgaaattgtgttggttggtggatcc
actcgtatccccaagatccaagaaattctgtcagatcatttcaacaagaaagagttgaac
aaatctatcaaccctgacgaggctgttgcatatggtgctgctgttcaggccgctattctt
catggcgacaaagatgagactgtccaagacttgcttctccttgatgttgcacccctttct
cttggtctggaaacagctggaggtgtgatgacatctattatcaagcgaaatactaccatt
cctactaaacaaaatcagatcttcactacctactctgacaaccagcctggtgtactcatt
caagtctatgaaggtgaacgtgcccttaccaaagaaaacaaccttcttggcaagtttgag
ttgacaggaatcccacctgcaccccgtggagtacctcagattgatgtcacatttgatgtt
gatgccaatggtattctcaatgtgagtgctgtagataagagcacaggcaaggagaataag
atcacaatcacaaatgacaaagggcgactgtccaaggaggacatagaacgtatggtccaa
gaagcggagaagtacaaggatgaggatgaaaaaatcaaagaaaaaattcaagccaagaac
tccttggaaagctatgcatataacatgaaacagaccatcgaagatgacaaggtcaaagat
aaaatcccagaagatgagagacagaaggtaattgacaagtgtaaagaagtgattgactgg
cttgatgtcaaccaatctgctgataagtctgaatatgatgctaagcagaaagagattgag
caagtatgtagtcctgtgataaccaaattgtatcaaggtgctggaggagcagcaggagct
cccccaggtggcttcccaggtgcaccaggaggtgatgcagcaccaggyggtggtggatca
tcaggacctaccattgaagaggttgactaa

DBGET integrated database retrieval system