KEGG   Exaiptasia diaphana: 110254791
Entry
110254791         CDS       T05080                                 

Definition
(RefSeq) 17-beta-hydroxysteroid dehydrogenase type 6
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
epa  Exaiptasia diaphana
Pathway
epa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    110254791
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     110254791
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 110254791
NCBI-ProteinID: XP_020917493
Position
Unknown
AA seq 337 aa
MEALYEAVNCPQVAIAVAVVVIGTLYLVSKLIHGGRVQNPDDKYVLITGCDRGFGKMAAI
RLDQLGFHVIATCLTDESQKELKEEASNKLTTFKLDVTKCDQVQDVYHKVTALIPRDKGL
WGVVNNAGVATVGLVDWVSLETFKRSADVNLWGMIDVTKTFLPLIKKTKGRIVNVTSXGG
RACLPNAVAYSVSKFAAEAFSDALRREIADFGVKVSIVEPGFFQTPMVTKANLSNAWRDV
WNKLDKEKQEEYGEEFYXIQVENMLVGMVDTCCSPSTYKVIDAIEHAVTSTRPNSRYVIG
WDANLLWIWLSRLPASVGDFIVQMLANKRGVPRSLQK
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaagctctgtacgaggctgttaactgtcctcaagtagcaattgccgttgccgttgtg
gttataggaactctatacttggtttctaagcttatccacggtggtcgagtccaaaaccct
gatgataaatatgtactcattactggttgtgatagaggattcggtaaaatggctgcaatt
cggttagatcagcttggttttcacgtaattgcgacctgcctgaccgatgaaagtcagaag
gagcttaaagaagaagcaagcaacaagttgactacatttaaacttgatgtcactaaatgc
gaccaagtacaagatgtatatcataaagttactgctcttattcctagggataaaggtttg
tggggagttgtcaacaatgctggcgtggctacagttggactcgttgactgggtttctctt
gagacrtttaaacgatctgctgacgtcaatttgtggggcatgattgacgtcacaaagact
ttcttaccyctcatcaagaagaccaaaggacgaattgtgaatgttactagcatkggaggt
cgtgcttgtcttcctaatgcagtagcttatagcgtttctaagtttgcagctgaagcgttt
tcggatgcgctacgacgagaaatagctgattttggtgtcaaagtaagcatcgtggaacca
ggtttttttcaaactccaatggttaccaaagcaaacctcagcaatgcgtggcgtgacgta
tggaacaagcttgataaagaaaaacaggaagaatacggtgaagaattctacraaattcaa
gtcgaaaacatgttggtgggtatggttgacacgtgctgttcgccaagcacctacaaagtg
attgacgcgatcgaacatgccgtgacgtcaacacgacctaattctcgttacgtgattggc
tgggatgcaaacctattgtggatatggttgtcaaggttaccagccagtgttggtgatttc
attgtgcagatgttggcgaacaagcgaggtgttccacgaagtttacaaaagtag

DBGET integrated database retrieval system