KEGG   Erwinia persicina: CI789_00415Help
Entry
CI789_00415       CDS       T05618                                 

Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
epe  Erwinia persicina
Pathway
epe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:epe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CI789_00415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:epe03400]
    CI789_00415
Enzymes [BR:epe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CI789_00415
DNA repair and recombination proteins [BR:epe03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CI789_00415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: AXU93836
UniProt: A0A3S7RZE9
Position
101322..104855
Genome map
AA seq 1177 aa AA seqDB search
MNQRVPERLDPLILPLHGERLIEASAGTGKTFTIGLLYLRLLLGLGGEAAFSRPLSVEEI
LVVTFTEAATAELRGRIRANIHELRIACVRGESQNPMLAALMAEITDLSRAASMLLAAER
QMDEAGIFTIHGFCQRMLNLNAFESGMLFEQVLIEDETPLRRRATADFWRRHCYPLPLPV
ARVVRQLWDGPEQLLKTLSPWLGGEAPVLKSAPAPDETLAQRHEKIIAQIDALKQAWLAA
GDLLSLVESSGVDKRSYSSKHLPNWLEKITQWAQTVTEDYEVIKDLERFGQRVLSEKTKK
GEPPRHALFEQIDAFLAQPLSLRDLVIARALHEVRFVTQQEKRLHAQLGFDDLLGRFDAA
LQQPGGAALAMAIRQRYPVALIDEFQDTDPQQYRIFHTLYAGQPDSALLLIGDPKQAIYA
FRGADIFTYMKARAEVSAHYTLETNWRSSPAMVESVNQLFLHQRNPFLFSDIPFITVSPA
EPNASLSFSIGGEEQPALQFWLQPGEGVGVSDYQQFMARQCAAEIRRWLTAGQQGTALIG
KVGKQQPVRASDITILVRSRSEASVMREALKGLAIPSVYLSNRDSVFTTPEAREVLWLLQ
AVLAPEQERTLRSALASSLLGLDARELDALNQDERAWDALVDEFAEYRQRWLKRGVLPML
RDLMVKRHIAENLLASDSGERRLTDLLHLGELLQEAAATLDSEHALVRWLAQMVEQPDGQ
VSNQQLRLESDRHLVQIVTIHKSKGLQYPLVWLPFVANFREAENGVYHDRQTFEALLDLQ
QGEESVALAGEERLAEDLRLLYVALTRSVFHCSVGIAPLIKGTRKKEGNSDLHRSALGYL
IQQGEPADAVGLRAALLTLQSAATAIMHPLEPDDTPWQPEREDPQVLSSQPMRRSLRDDW
RVTSYSGLQQHGHSPALDLLPRLDVDAVGEATDELLPQLTPHSFPRGAAPGTFLHGLFET
LEFTAPLDDGWLAQQLSGQGLDEAWLPVMRDWIERILTTPLNESGVCLQQLTPDVRRVEL
QFYLPISRLLTADALDNVVRQDPLSAECPPLDFYQVQGMLKGFIDLVFCWQGKYYLLDYK
SNWLGEDSHAYTQEAMAQAMRSHRYDLQYQLYTLALHRYLRHRLADYDYDRHFGGVIYLF
LRGLDGAEGSNGIYSTRPQTAFVTALDRLFANDAEPA
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacgggtacctgagcggctcgatccgttaatcctgccgctgcatggcgaacgg
ctgattgaggcctcggccggcaccgggaaaacctttaccatcgggctgctgtatctgcgc
ctgttgctggggctgggcggcgaggccgccttcagtcgtccgttgtcggtggaagagata
ctggtcgtcacctttaccgaagccgccacggcggagctgcgcgggcgtatccgcgccaat
attcacgaactgcgcattgcctgtgtgcggggggagagtcagaatccgatgctggcagcc
ctgatggccgaaataactgacttatcccgggcggcatcgatgctgctggcagcggaacgg
cagatggatgaggccgggatctttaccattcacggcttctgccagcgtatgctcaacctc
aatgcctttgaatcaggcatgctgtttgaacaggttttaattgaggacgaaacgccgctg
cgccgccgggccacggcggatttctggcgcaggcactgttatccgctcccgctccctgtc
gcccgggtggttcgccagctctgggacgggccggaacagctgttgaaaacgctgtcgccg
tggctgggtggtgaagcaccggtattaaaatctgcaccggcgcctgatgaaacgctggcg
cagcgtcatgagaaaattattgcgcaaatcgatgcgctgaaacaggcgtggctggcagcg
ggcgatctgctgtcgctggtggaatcctctggcgtagacaagcgaagttacagtagtaag
cacttaccaaactggctggagaaaatcacccagtgggcgcagacagtgacggaagactat
gaggtgattaaagaccttgaacgcttcggtcagcgcgtgctgtcagagaaaacaaaaaag
ggcgagccgccccgtcatgcgctgtttgagcagattgatgcgttcctggctcaaccgctt
tcgctgcgcgacctggtgattgcccgcgcgctgcacgaagtgcgctttgtgactcagcag
gagaaacgtttgcatgcccagctcggctttgacgatctgctcgggcgttttgatgcggcg
ttacagcagcctggcggcgcggcgctggcgatggctatccgtcaacgctatccggtggcg
ctcatcgatgagttccaggacaccgatccgcagcaatatcgcatatttcatacgctgtat
gccggacagccggacagcgcactgctgctgatcggggatccgaaacaggctatctatgct
ttccgtggagcggatatcttcacctacatgaaagcacgcgcagaagttagcgctcactat
acgctggagaccaactggcgatcatcaccggcgatggttgagagcgttaatcagctgttt
ttacaccagcgtaacccctttctcttcagcgatatcccctttatcaccgtgagtccggca
gaacccaacgccagcctgagttttagcatcggcggcgaagagcagccggcgctgcaattc
tggttacagccgggcgagggtgtgggggtaagtgattaccaacagtttatggcgcgccag
tgtgcggcggagatccgccgctggcttacggcgggccagcagggcaccgcgctgatcggc
aaagtgggaaaacagcagccggtacgcgcctcagatattactatcctggtgcgcagccgc
agtgaggcgtcggtgatgcgggaggcgctgaagggtctggcgatcccgtcggtgtacctc
tctaaccgcgacagcgtcttcaccaccccggaagcccgggaggtcttgtggctgctgcag
gcggtgctggcgcctgaacaggagcgcacgctgcgcagcgcgctggccagcagtctgctg
ggcctggatgcgcgggaactggatgcgctgaatcaggatgagcgtgcctgggatgcgctg
gtggatgagtttgctgaataccgtcagcgctggctgaagcgtggcgtgctgccgatgctg
cgcgatctgatggtgaaacggcatattgccgaaaacctgctggcctccgacagcggtgaa
cgtcgcctgacggacctgcttcatctgggcgaactgttgcaggaggcagcggcgaccctg
gacagtgaacatgcgctggtgcgctggctggctcaaatggtggaacaaccggatggccag
gtcagcaatcagcagctgcgccttgagagcgaccgtcacctggtgcagattgtcaccatt
cacaaatcaaaaggcttacagtatccactggtgtggctgccgtttgtcgccaatttccgt
gaggcggaaaatggcgtctatcacgaccgccagacgtttgaagcgctgcttgacctgcaa
cagggtgaagagagcgtggcgctggccggggaggagagactggctgaagacctgcgtctg
ctttacgtcgcgctgacccgatctgttttccactgcagcgtcggcatcgcgccgttgatc
aaaggcacccgtaaaaaagaaggtaacagcgacctgcaccgtagcgccctgggctatctt
attcagcagggggaaccggcggatgcagtgggtctgagggccgccctgctgacgctgcaa
agcgccgcgacggcgattatgcacccgctggagccagacgatacgccctggcagccggag
cgggaagatccgcaggtactgagcagccagccgatgcggcgttcactgcgcgacgactgg
cgcgtgaccagttattccggcctgcaacagcatggccattccccggcgctggacctgctg
ccgcgcctggatgtggatgcggtcggtgaagccactgatgagctgctgccacagctgaca
ccgcacagttttcctcgcggtgcggcaccgggcacgttcctgcacggtctgtttgaaaca
ctggaattcaccgctccgctggacgacggctggcttgcacaacagctgagtggccagggg
cttgacgaggcctggcttcccgtcatgcgtgactggattgagcgtattctgacaacgcca
ttgaatgagagcggtgtctgtctgcagcagctgacaccggacgtcagacgggttgagcta
cagttttacctgccgatttcacgtctgctcaccgcagacgcgctggataacgtcgtgcgc
caggatccgctctctgctgagtgcccccccctcgatttttatcaggtgcagggcatgctg
aaaggctttatcgatctggtgttctgctggcaggggaaatattacctgctggactacaaa
tcgaactggctgggggaagacagtcacgcctatacccaggaggcgatggcgcaggcaatg
cggtcgcatcgttacgaccttcagtatcagctttatacgctggcattgcatcgctatctg
cgccatcgcctggcggactacgactatgaccgtcattttggcggcgtcatttatctgttc
ctgcgtggcctggacggcgcggaggggagcaacgggatttacagcacacggccgcagaca
gcgtttgtcaccgcccttgatcggctgtttgcaaacgacgcggagcctgcatga

DBGET integrated database retrieval system