KEGG   Erwinia persicina: CI789_00990Help
Entry
CI789_00990       CDS       T05618                                 

Definition
(GenBank) 23S rRNA pseudouridine(1911/1915/1917) synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
epe  Erwinia persicina
Brite
KEGG Orthology (KO) [BR:epe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:epe03009]
    CI789_00990
Enzymes [BR:epe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CI789_00990
Ribosome biogenesis [BR:epe03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CI789_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 CRISPR_assoc
Motif
Other DBs
NCBI-ProteinID: AXU93936
UniProt: A0A354AHD1
Position
223246..224223
Genome map
AA seq 325 aa AA seqDB search
MAQQVKLNATVSESQLGQRLDQALAELFPDYSRSRIKEWILDRRITVNGAIIDKPKEKVL
GGEQITLDAEIDEEARWEAQDIALNIVYEDDDILVINKPRDLVVHPGAGNPDGTVLNALL
HHFPAIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTHLVESLQLREFTREYEAVAIGRMT
AGGTVDQPISRHSTKRTHMAVHPMGKPATTHYRIMEHFRAHTRLRLRLETGRTHQIRVHM
SHINHPLVGDPLYGGRPRPPKGASEAFISTLRGFDRQALHATMLRLYHPITGIEMEWHAP
LPQDMVELINALKADTEEFKEQLDW
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacaagtaaaactcaatgcaacggtatccgaatcgcaactcggacaacggtta
gatcaggctttggccgaattgttccctgattattcccgttctcgcataaaagaatggatc
ctcgaccgccgcatcaccgtcaatggtgcaataatcgacaaaccgaaagaaaaagtgctc
ggcggtgagcaaattactctcgatgcggaaattgatgaagaagcccgctgggaagcccag
gacattgccctgaacatcgtctacgaagatgacgatattctggtgatcaataaaccgcgc
gacctggtcgtacatccgggggccggtaatcctgacggcacggtgctgaatgcactgctg
caccatttcccggcgattgccgatgtgcctcgtgccggtattgtgcatcgtctggataaa
gacaccacgggcctgatggtagtggcaaaaacggtaccggctcagacgcacctggtggag
tcgctgcagctgcgcgagtttacccgtgaatatgaagccgttgctattggtcgcatgacg
gcgggcggtacggtcgatcagcccatcagccgccattcgacgaagcgtactcacatggca
gtacacccgatgggcaaaccggccaccacgcactaccgtattatggagcacttccgtgcc
catacgcggctgcgtctgcggctggaaaccggacgtacgcaccagatccgtgtgcatatg
tcgcatatcaatcatccgctggtgggtgacccgctttatggcggccgtcctcgcccacca
aaaggggcctccgaagcctttatcagcactttgcgtggtttcgaccgtcaggctttacat
gccacgatgctgcgtctctatcacccgatcaccgggattgaaatggaatggcatgcgcct
ctgcctcaggacatggttgagttgatcaatgccctgaaggccgataccgaagagttcaaa
gagcagctggactggtaa

DBGET integrated database retrieval system