KEGG   Erwinia persicina: CI789_07160Help
Entry
CI789_07160       CDS       T05618                                 

Definition
(GenBank) NAD-dependent epimerase
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
epe  Erwinia persicina
Pathway
epe00520  Amino sugar and nucleotide sugar metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CI789_07160
Enzymes [BR:epe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     CI789_07160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 NAD_binding_4 adh_short KR NmrA adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AXU95019
UniProt: A0A354DQT8
Position
1541944..1542951
Genome map
AA seq 335 aa AA seqDB search
MKYLVTGAAGFIGFHVTQRLLAAGHQVVGLDNLNDYYDVNLKTARLDLINTHPNFTFMKG
DLADREGIAELFRSQRFQRVIHLAAQAGVRYSLENPLAYADANLIGHLNILEGCRHNQVE
HLLYASSSSVYGLNRKMPFSTDDSVDHPVSLYAATKKANELMSHTYSHLYGIPTTGLRFF
TVYGPWGRPDMALFKFTRAIIAGEKIDVYNHGQMRRDFTYIDDIAEAILRLQDVIPQADI
NWTVESGSPATSSAPYRVYNIGNSQPVTLMKYIEALESALGQVAEKNMLPMQPGDVMETS
ADTTALYKVIGFKPQTSVEEGVARFVEWYKDFYQK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctggtcaccggcgcagcaggatttattggctttcatgtcactcaacgtctg
cttgccgccggtcaccaggttgtcggtctcgacaacctgaatgattattacgatgttaac
cttaagacggcacgtcttgatctgattaacacccacccgaattttacctttatgaaaggc
gacctggccgatcgtgaaggcatcgctgagctgtttcgctctcagcgcttccaacgtgtt
atccaccttgctgctcaggcgggggtgcgttattcactggaaaaccccctggcttatgct
gatgccaacctgattggccaccttaatatcctggaagggtgccggcataatcaggtggaa
catttgctgtatgcttcttccagctcggtatatgggctgaaccgtaaaatgccattctca
acggacgactcagttgaccatccggtatccctttacgcggcgacgaagaaagccaatgag
ctgatgtcacatacctattctcatctgtatggtattcccaccaccggcttacgtttcttt
accgtctatggcccgtgggggcgtccggatatggcactgtttaaattcacccgagcgatt
atcgcgggtgaaaaaattgatgtgtataaccatggtcagatgcgacgcgactttacctat
atcgatgatattgccgaagctattcttcgtttgcaggatgttatcccacaggcggatata
aactggacggtggaaagtggcagtccggccaccagctctgcgccttatcgcgtttataat
atcggtaatagtcaaccggtcacgctgatgaagtatattgaggcgctcgaaagcgctctg
ggacaggttgctgaaaagaatatgctgcctatgcagccgggtgacgtgatggaaaccagt
gcggatacgacagcgctttacaaagtcattggtttcaaacctcaaacctcagtagaagag
ggtgtggcccgctttgtagagtggtacaaagatttttatcagaaataa

DBGET integrated database retrieval system