KEGG   Erwinia persicina: CI789_12670Help
Entry
CI789_12670       CDS       T05618                                 

Definition
(GenBank) hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
epe  Erwinia persicina
Brite
KEGG Orthology (KO) [BR:epe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CI789_12670
Enzymes [BR:epe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CI789_12670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AXU97885
UniProt: A0A3Q8HC45
Position
complement(2700908..2701696)
Genome map
AA seq 262 aa AA seqDB search
MKVALGQFAVSREWQENAHTCIALMQQSEQQGVRLLVLPEAVLARDINDPDLAVKSAQAL
NGPFMSQLLAASSDNTLTTVLTLHVPGEDGRVLNVLVAIRGGIILARYDKLHLYDAFAVQ
ESRHVSPGDRIPPLVEVDGLKVGLMTCYDIRFPELARRLVLDGADLLVLPAAWVRGPLKE
KHWEVLVTARALENTCYVLATGECGPRNIGNSLVVDPLGVAIARAAEGPALVLADIDPER
IADVRRALPVLANRRFGRPELS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggctttagggcagtttgccgtcagtcgtgaatggcaggaaaatgcgcatacc
tgcatcgcgttaatgcaacaatcagaacagcagggcgtccgcttactggtgttacctgag
gccgtgctggcaagggatattaacgatcctgacctagccgttaaatctgctcaggcgctg
aatggcccctttatgagccagttgcttgctgccagcagcgataataccctgaccacggtg
ctgacgttgcatgtgccgggcgaggacgggcgtgtactcaacgtactggtcgccatccgt
gggggcatcatccttgcgcgttatgacaaactccacctgtatgatgcttttgccgtacag
gagtcacgtcatgtgagccctggcgacaggataccgccactggttgaggtggatggcctg
aaggtcgggctgatgacctgctatgacatccgttttcctgagctggctcgccgtctggtg
ctggatggtgccgatctgctggtgttacccgctgcatgggtgcgcggaccgctgaaagag
aagcactgggaagtgctggtcaccgcgcgggcgctggaaaatacctgctatgtcctggcc
accggggagtgcgggccacgcaatatcggtaacagcctggtggtggacccgcttggtgtg
gccattgccagagcggcagaggggccggcgctggtactggcagatattgaccctgaacgc
attgctgacgttcgccgtgcactcccggtgctggctaatcgccgctttgggcgccctgag
ctctcctga

DBGET integrated database retrieval system