KEGG   Erwinia persicina: CI789_17000Help
Entry
CI789_17000       CDS       T05618                                 

Definition
(GenBank) TenA family transcriptional regulator
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
epe  Erwinia persicina
Pathway
epe00730  Thiamine metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CI789_17000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:epe03000]
    CI789_17000
Enzymes [BR:epe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     CI789_17000
Transcription factors [BR:epe03000]
 Prokaryotic Type
  Other transcription factors
   Others
    CI789_17000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AXU96762
UniProt: A0A3S7S7S9
Position
complement(3602403..3603050)
Genome map
AA seq 215 aa AA seqDB search
MTEAFSERLLREHQPAWQAMQQHPFVTDIERQQLPAAVFNRYLVFEGQFVATAIAIFALG
VSKAPDIRSQRWLIGVLNALVDTQIAWFDAVLARRQINPADYPGDLPGVRRFDDGMRQAA
QEGSYAEIITLMFGAEWMYYHWCHRVNEQTLQDDDVRCWVSMHAGEAFYQQACWLKEELN
RCADALSEAEKQALSALYGRVLQWEIDFHTAAYPG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggcattcagcgaacgtctgctgcgcgagcaccagcccgcgtggcaggccatg
cagcagcatcctttcgtcacggatattgagcggcaacagctgccggcggcggtgtttaat
cgttacctggtgtttgaggggcaatttgtcgccacggcgatcgctatctttgccctgggt
gtcagtaaagcgccggatattcgctcacagcgctggctgatcggcgtcctcaatgcgctg
gtagatacccagatcgcctggtttgacgctgtgctggcccggcggcagatcaatcctgcc
gactatccgggcgatctgcccggggttcgccgctttgacgacgggatgcgacaggcggcg
caggagggcagctatgcggaaattattaccctgatgtttggcgcggaatggatgtattac
cactggtgtcaccgggtgaatgaacagacgctgcaggatgacgacgtgcgatgctgggta
tcgatgcatgccggagaggccttttaccagcaggcatgctggctgaaagaggagctgaac
cgctgtgcagatgcgttgagtgaggcagaaaagcaggcgctttcggcgctttacggcaga
gtgctgcagtgggagatcgattttcacacggcggcgtaccccgggtga

DBGET integrated database retrieval system