KEGG   Erwinia persicina: CI789_17880Help
Entry
CI789_17880       CDS       T05618                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
epe  Erwinia persicina
Pathway
epe00471  D-Glutamine and D-glutamate metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CI789_17880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:epe01011]
    CI789_17880
Enzymes [BR:epe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CI789_17880
Peptidoglycan biosynthesis and degradation proteins [BR:epe01011]
 Precursor biosynthesis
  Racemase
   CI789_17880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AXU96903
UniProt: A0A3S7S884
Position
complement(3790390..3791241)
Genome map
AA seq 283 aa AA seqDB search
MAMTPLDGNTTSAAATPSKPRPTVLVFDSGVGGLSVYDEIRKLLPDLHYLYAFDNVAFPY
GEKSEAFIVERVVAIVEAVTRRYPLALVVIACNSASTVTLPALRERFAFPVVGVVPAIKP
AARLTRNGVVGLLATRGTVKRPYTHELVARFGSECKTEMLGSAELVELAEAKLHGQPVSI
DDVKRILQPWLRMQEPPDTVVLGCTHFPLISEELQQVLPEGTRLIDSGAAIARRTVWLLE
NESPDAFSPDENMAFCMDISEQAVQLMPVLQRYGFTKLEKLSL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacacccctggacgggaatactacctcagcggcagctacaccttctaaaccg
cgtcccaccgtgctggtttttgattccggcgtcggtgggctttcagtctatgatgagatc
cgcaaattgctgccggatctccattatctctacgcgttcgataatgtcgctttcccttat
ggcgaaaagtcggaagcgtttatcgtcgagcgtgtggtcgctatcgttgaagcggtgacc
cgccgttatcccctggctctggtggtgatcgcctgtaactcagcgagtaccgtcacgctg
cccgctttacgcgagcgctttgcatttcctgttgtcggtgtggttcctgctataaaaccg
gcagcgcgcctgactcgtaatggggttgttggcctgctggcgacccgggggacggtgaaa
cgtccttatacgcatgagctggtggcgcgttttggcagtgaatgtaagaccgagatgctg
ggatcggcggagttggtagagctggcggaagccaaactgcatggccagcctgtttctatc
gatgacgtgaagcgcatcctgcagccgtggctgcgtatgcaggaaccaccggataccgtc
gtcctgggctgcacgcatttccctcttattagtgaagagctacagcaggtactccctgaa
ggtacccgtttaatcgattctggtgcggcaattgcgcgtcgaacggtgtggttactggaa
aatgagtcgccagacgctttttcgccggatgagaacatggcgttctgtatggatattagt
gagcaggcggtacaattaatgcccgttttacaacgatatggcttcacaaagctcgaaaaa
ctgtcgctttag

DBGET integrated database retrieval system