KEGG   Erwinia persicina: CI789_23830Help
Entry
CI789_23830       CDS       T05618                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
epe  Erwinia persicina
Pathway
epe00250  Alanine, aspartate and glutamate metabolism
epe00650  Butanoate metabolism
epe00760  Nicotinate and nicotinamide metabolism
epe01100  Metabolic pathways
epe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CI789_23830
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CI789_23830
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CI789_23830
Enzymes [BR:epe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     CI789_23830
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     CI789_23830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXU98227
UniProt: A0A3Q8HJL5
Position
pEP2:complement(95941..97326)
Genome map
AA seq 461 aa AA seqDB search
MTHISSAVAISRNPTTGEVVARYPFASGTEVDEALALTYTAFRTWRHSAITDRVRLLQNI
AGGLRQQAQPLAEMMTREMGKPVDQGLAEVEKSARLCEWYGEHGPAFLEREPTQVEGDKA
FVDYLPLGPVLSVMPWNFPVWQVLRGAVPIILAGNSYLLKPAPNVMGCALLLQQILTAAG
VPEGLFAVVNADNDGVAQAINDKRIAAVTVTGSVRAGGAIAALAGAAIKKCVLELGGSDA
FIVLADADIDAAVKGAIAGRFMNNGQLCISAKRIIVEAAVFEQFSEKFVSAVKAMKIGDP
REPGTWIGPMARYDLRDELDAQVQATLKEGATLLVGGHALPGEGNYYAPTVLSDVKPGMT
SFDQELFGPVASLIVADDAAHAVAMANDSEFGLGGSLWSRDLDRAQRLASQIETGGVFIN
SPSFSDPRVPIGGVKKSGFGRELSHFGLREFTNAQTVWVES
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgactcatatttcttcagcggtagccatttcacgtaaccccaccacaggtgaggtcgtt
gcccgctatcctttcgccagcggaacagaggtggatgaggcgctggccttaacctacacg
gccttccggacatggcggcacagcgccatcactgatcgtgtcaggttgctgcaaaacatc
gccggtggcttgcgtcagcaggcgcagcccctggcggaaatgatgacccgcgagatggga
aaacccgtggatcaggggctggcggaagtcgagaaaagcgccagattgtgcgagtggtac
ggcgagcacggcccggctttccttgagcgtgaaccgacgcaggtggagggcgataaggcc
tttgtcgattacctgccgctggggccggtgctgtcggtaatgccgtggaattttccggtg
tggcaggtgctgcgcggtgccgttcccatcatactggcggggaacagctatctgctgaag
cctgcgccgaacgtgatgggctgcgcgctgttattgcagcagatcctgacggcggcgggc
gtgcctgagggcctgtttgcggtggttaatgctgataatgacggtgtggcgcaggcgatt
aatgataaacgtattgcggctgtaaccgtgaccggcagcgtgcgtgccggtggagccatt
gctgccctggccggtgccgccattaagaaatgcgtgctggagttgggcggttcggatgcc
tttatcgtcctggccgatgcggatattgatgccgccgtgaagggggcgatcgccggacgg
tttatgaataacggtcagctctgcatttctgccaaacgtatcattgtggaggccgccgtc
tttgaacagttcagcgagaaatttgtcagcgcggtgaaagcgatgaaaatcggcgatcca
cgcgaaccggggacctggattggtccgatggcccgctacgatctgcgtgacgaactggac
gcgcaggtgcaggccaccctgaaagagggggccacgctgctggtgggcggccatgctctg
ccgggtgagggtaattactatgcgcctacggtgctgagcgacgttaagcccggtatgacc
agcttcgaccaggagctgttcggcccggtggcctcactgattgtggcggacgatgccgct
cacgcggtggcaatggccaatgactccgagtttggcctcggcggcagcctgtggagccgc
gatctggacagggcgcagcgtctggcgtcacagattgaaactggcggcgtgtttattaac
tccccgagtttctccgatccgcgcgtgccgattggtggcgtgaaaaaaagtggctttggc
cgcgaactgtcacacttcggcctgcgcgagttcaccaatgcgcagacggtatgggtggag
tcctga

DBGET integrated database retrieval system