KEGG   Endomicrobium proavitum: Epro_0330Help
Entry
Epro_0330         CDS       T03965                                 

Gene name
rfbE
Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
epo  Endomicrobium proavitum
Pathway
epo00520  Amino sugar and nucleotide sugar metabolism
epo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Epro_0330 (rfbE)
Enzymes [BR:epo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     Epro_0330 (rfbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 KR adh_short NmrA NAD_binding_10 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKL97709
UniProt: A0A0G3WJN5
Position
complement(427801..428829)
Genome map
AA seq 342 aa AA seqDB search
MKLLITGGCGFLGSNLAAHALEQKYDVLVFDNLHRKGSQENLAWLQTKNKFQFIKEDTKN
FDAVAKAVKEFQPDSIFHLAGQVAMTTSIANPRLDFETNALGTFNILEAVRQFSPQSNII
YSSTNKVYGDLEQYTYSQQETRYVCNEKPEGFDENVTLDFHSPYGCSKGSADQYMLDWSR
MFGLKTAVFRHSSMYGGRQFATADQGWIGWFCQKAVETKLDILKEPFTISGNGKQVRDVL
HAKDMVSLYFSCIKNIDKAKGNAFNIGGGFENSLSLLELFDYLEKILDIKLNYTKLPPRG
SDQKVFIADIKKARKLIGWKPEVNYKEGIKQMLEWTKTQVIK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgctaattacaggcggctgcggatttttaggaagcaatcttgccgcgcacgct
ttagaacaaaaatacgacgttcttgtttttgataatttgcatagaaaaggttctcaagaa
aatcttgcgtggttacagactaaaaacaaatttcaatttattaaagaggatacaaaaaat
tttgacgccgtcgcaaaagccgtaaaagagtttcagccggattcaatttttcatcttgcc
gggcaagtggcaatgacaacctctatcgcaaacccgcggttagattttgaaacaaacgcg
cttggcacatttaatattttagaagccgtaagacaattttcgcctcaatcaaatataatt
tattcttcaacaaataaagtttacggagatttggaacaatatacatactcgcagcaagaa
acaagatacgtttgcaatgaaaaaccggaaggttttgatgaaaatgtaacgcttgatttt
cattccccttacggctgttctaaagggtcagccgaccaatacatgcttgactggtcaaga
atgttcggattaaaaaccgccgttttccgtcacagctccatgtatggaggaagacagttt
gcaaccgccgatcaaggttggataggctggttctgccaaaaagcggtggaaacaaaatta
gatattttaaaagagccgttcacaatatccggaaacggcaaacaggttagagacgtttta
catgcaaaagatatggttagtttatatttttcttgtattaaaaatattgacaaagcaaaa
ggcaacgcgtttaacataggaggaggatttgaaaacagtttatcgctccttgaacttttt
gactatcttgaaaaaattttagatataaaactaaattacacaaaactcccgccgcgcgga
agcgaccaaaaagtttttattgcagacattaaaaaagcgcgcaagcttataggctggaaa
ccggaagtaaattacaaagaaggcatcaagcaaatgttagagtggacaaagacacaggtg
ataaaataa

DBGET integrated database retrieval system