KEGG   Endomicrobium proavitum: Epro_0375Help
Entry
Epro_0375         CDS       T03965                                 

Definition
(GenBank) PHP family metal-dependent phosphoesteraseputative metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
epo  Endomicrobium proavitum
Brite
KEGG Orthology (KO) [BR:epo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Epro_0375
Enzymes [BR:epo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Epro_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-ProteinID: AKL97754
UniProt: A0A0G3WJT0
Position
486653..487507
Genome map
AA seq 284 aa AA seqDB search
MSEFYVDLHIHTHYSDGVLTPAEVVERAKKLKLAAISITDHDSVEGIEEAVSAAAGTNLE
VIAGIELSSQADTSPKSEMHILGYYINYKSESFRAALEVFKKARLERAYKILEKLKENGI
VLKNESFITDNNKKSVGRLHFAKALIEEGFVGSIQEAFQRYLAEGKPAYVPKFHISANDA
VKLIKSVGGVAVMAHPYYAHYNDRAMLDALIKSGLDGLEAWHIKHPESAVKKFLSLTQEL
GLIATGGSDCHGPYKNEPPIIGRVKVPYSVIENLEKAKERQSVK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagttttatgtggatttgcatattcatactcattattccgacggggttttaact
cctgcggaagttgttgaacgcgctaaaaaacttaagcttgcggctataagcattacagac
cacgacagcgtggaaggcatagaagaagccgtttcggctgctgcgggaacaaatcttgag
gtaattgccggaatagaactttcttctcaggcggatacttcgccgaaaagcgaaatgcat
attttgggttactacataaattataaatccgaaagtttcagagcggctcttgaggttttc
aaaaaagcgcgccttgaaagagcttataaaattttagaaaagcttaaagaaaacggcata
gttttaaaaaacgaaagttttattaccgataataataaaaaatccgtcggcagacttcat
ttcgcaaaagctttaattgaagaaggctttgtaggaagcattcaggaagcctttcaaaga
tatcttgccgaaggcaaaccggcttatgttcccaaatttcatatcagcgcaaacgatgcg
gtaaaacttataaaaagcgtcggcggagttgcggttatggcgcacccgtattacgcgcat
tacaacgacagagcaatgcttgacgctttaataaaatccggtcttgacggtcttgaagct
tggcacataaaacatcctgaaagcgccgtgaaaaaatttttatctcttacgcaggaactc
ggtcttatagccaccggcggttccgattgtcacggaccgtataaaaacgagcctccgata
atcggcagagtgaaagttccgtattcggttattgaaaatttagaaaaagcaaaggaaaga
caaagtgtaaaatga

DBGET integrated database retrieval system