KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00130Help
Entry
EPYR_00130        CDS       T02121                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00010  Glycolysis / Gluconeogenesis
epr00051  Fructose and mannose metabolism
epr00562  Inositol phosphate metabolism
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01120  Microbial metabolism in diverse environments
epr01130  Biosynthesis of antibiotics
epr01200  Carbon metabolism
epr01230  Biosynthesis of amino acids
Module
epr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
epr_M00002  Glycolysis, core module involving three-carbon compounds
epr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_00130 (tpiA)
   00051 Fructose and mannose metabolism
    EPYR_00130 (tpiA)
   00562 Inositol phosphate metabolism
    EPYR_00130 (tpiA)
Enzymes [BR:epr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EPYR_00130 (tpiA)
Exosome [BR:epr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EPYR_00130 (tpiA)
  Exosomal proteins of bladder cancer cells
   EPYR_00130 (tpiA)
  Exosomal proteins of melanoma cells
   EPYR_00130 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAY72422
UniProt: D2TC45
Position
complement(144189..144956)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGNKHMVNELIAGLRTELSGVDGCGVAIAPPVMYLDQAKQAISGSPVA
LGAQNVDVNLSGAFTGEVSAEMLKDIGARYIIIGHSERRTWHAESDELIAKKFAVLKATG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLNSQGADAFTGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAQKDATVAAQVIIQYGGSVNDKNAAELFAQPDIDGALVGGASLKAD
AFAAIVKAAAAAKRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagtgatgggtaactggaaactcaatggcaacaagcacatggtcaac
gaactgatcgccggtctgcgtaccgagctgagcggcgttgatggttgtggggtggcgatt
gctccccctgtcatgtatctggatcaggcgaagcaggccatttccggcagccctgtcgcc
ctgggtgcgcagaacgttgacgttaacctgtctggcgctttcactggcgaagtttctgcc
gagatgctgaaagacatcggcgcacggtacatcattattggccactccgagcgccgtacc
tggcacgcagaaagcgatgaactgattgcgaaaaaatttgccgtgctgaaggcgacgggt
ctgatcccggtgctgtgcattggtgaaaccgaagcggaaaatgaagcgggtaaaaccgaa
gaagtctgcgcacgtcagatcgatgcggtactgaattcgcagggcgctgatgctttcact
ggtgtggtgatcgcttatgaacccgtatgggcaatcggcacgggcaaatcagctaccccg
gctcaggctcaggcagtacacaaatttatccgcgaccatatcgcgcagaaagatgcgacg
gtggccgctcaggtcatcattcagtacggtggttctgtgaacgataaaaatgcggcagag
ctgtttgctcagccagatatcgacggcgctctggtgggcggcgcatccctgaaagccgat
gccttcgcagcgattgttaaagcggcggcggcggcgaaaagagcctga

DBGET integrated database retrieval system