KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00646
Entry
EPYR_00646        CDS       T02121                                 

Definition
(GenBank) COG3521
  KO
K11906  type VI secretion system protein VasD
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:epr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EPYR_00646
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:epr02044]
    EPYR_00646
Secretion system [BR:epr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EPYR_00646
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAY73010
UniProt: D2T454
Position
712820..713338
AA seq 172 aa
MTMHRLSISRLITQSFLLAAFTLLAGCVSSSRSVPAQYSLVFQAHPQINDSAPLKVRVLL
LKSDADFMAADFYSLQTHPQAVLGQNLLNSEQFFLMPGQTDKKRVGQSSPEARYIGIMAE
YQTLDGKKWRVSLPVPLPAERHFYQIWQGDADNLRADVIADINGVRVINARD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgactatgcacagactctcgatttctcgcctgataactcagtcgtttttactggcagcg
tttaccctgctggccggttgtgtttcgtcttcacgcagtgtccccgcgcaatacagcctg
gtttttcaggctcaccctcagatcaatgattcggctccgctaaaggtgcgggtgctgttg
ctgaagtcggatgcggattttatggcggctgatttctactcgctgcaaacccatccgcag
gcagtgctggggcaaaacctgttgaacagtgagcagtttttcctgatgccggggcagact
gacaaaaaacgggtcgggcagagcagcccggaggcgcgttatatcggcattatggcggaa
tatcaaacgcttgatggcaaaaagtggcgagtttctttgccggtgccccttcctgccgaa
cgccatttttatcaaatttggcaaggggatgcggataatctgcgcgccgacgttatcgcc
gatatcaacggtgtccgtgttattaacgcccgcgattaa

DBGET integrated database retrieval system