KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00652
Entry
EPYR_00652        CDS       T02121                                 

Definition
(GenBank) COG3516: putative type VI secretion system,core protein
  KO
K11901  type VI secretion system protein ImpB
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
KEGG Orthology (KO) [BR:epr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:epr02044]
    EPYR_00652
Secretion system [BR:epr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EPYR_00652
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CAY73016
UniProt: D2T460
Position
721411..721947
AA seq 178 aa
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLDPQPGVDE
RKFLEIDVDNFDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPL
NQLLDARTQLANLLTYMDGKNGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
NT seq 537 nt   +upstreamnt  +downstreamnt
atggcagtcagtaaatccagtgggcaaaaattcattgcccgtaaccgcgcgccacgcgtg
cagattgagtacgacgtggaaatctatggtgcggaacgcaaaatccagctgcccttcgtg
atgggcgtgatgtccgacctggtcgggaaaccgctggatccgcagccgggcgttgatgaa
cgtaagttccttgaaatcgacgtcgacaacttcgacgaacgcatgaaggcgctcaaacca
cgcgtggcattccaggcagaaaacaccctgaccggagaagggcgtcttaatatcgatctg
acctttaacagcatggaagacttctcgccggatgcggtggcacgtaaagtcgagccactc
aatcagctgctggatgcccgtacccagctggctaacctgctgacctatatggatggcaaa
aacggtgcggaagaactgatcggcaaaatcctgcaggacccgacgctgctgcaatcactc
agccatctgccgaaagctgacgacaaggcagccgacgaccacggcaacaaggagtaa

DBGET integrated database retrieval system