KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00663
Entry
EPYR_00663        CDS       T02121                                 

Definition
(GenBank) putative type VI secretion system-associated hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
KEGG Orthology (KO) [BR:epr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:epr02044]
    EPYR_00663
Secretion system [BR:epr02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   EPYR_00663
SSDB
Motif
Pfam: ImpE TPR_19
Other DBs
NCBI-ProteinID: CAY73027
UniProt: D2T471
Position
732585..733406
AA seq 273 aa
MHSLQHLMDGQSLAETLARIESQIKRQPADADLRASFVQLLCLAGNWSRAQTQLKSWLAL
KPQAQPTVQLLDQTINAERQRAAVFAGEASPRMPGAAWNWAEQLLAALAADAAGDRAQAQ
RLRGCALEAAQLNPGQLTHQNQQQTFDWLTDGDGRLGPVCELIANGQYSWLPFSAISEIR
FQAPVSVTDLVWRHTLVRLVDGSEQVCQIPVRYPFVEQADDRYRLATLTEWQPLPGDDQQ
FSGHGQKCWFSADAEFPLLGMEMLAFSDAEPAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atgcattcgttacaacatctgatggacggccagtcgctggctgaaactctggcaagaatc
gaaagccagataaaacgccagcctgccgatgccgatctgcgcgccagctttgtccagctg
ctgtgcctggcgggcaactggagccgggcgcagacgcagctaaaatcctggctggcgctg
aaaccacaggcgcagcccacggtccagctgctggaccagacgattaacgctgaacgccag
cgtgcggcggtatttgccggtgaagcatcaccgcgtatgccgggcgcggcatggaattgg
gcagagcagctgctggccgcgctggcggccgatgccgctggcgatcgtgctcaggcgcaa
cggctgcgcggctgcgctttagaagcggcgcagctgaatcccgggcagttgacgcaccag
aaccagcagcaaacctttgactggcttacagacggtgacgggcggctcggcccggtgtgc
gaactgattgccaacggacagtacagctggctgccgttcagcgccatcagcgaaatacgc
tttcaggctccggtcagcgtcaccgacctggtatggcggcatacgctggtcagactggtg
gatggcagcgagcaggtgtgccagataccggtacgctatccgtttgtcgaacaggccgac
gaccgctaccggctggccacgctgaccgaatggcaaccgctgccgggcgatgaccagcag
ttcagcggccacgggcagaaatgctggttcagcgccgacgccgaattcccgctgctgggc
atggagatgctggcgtttagcgatgcagagccagccttatga

DBGET integrated database retrieval system