KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00664Help
Entry
EPYR_00664        CDS       T02121                                 

Definition
(GenBank) COG3518: putative type VI secretion system,core protein
  KO
K11897  type VI secretion system protein ImpF
Organism
epr  Erwinia pyrifoliae DSM 12163
Brite
KEGG Orthology (KO) [BR:epr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:epr02044]
    EPYR_00664
Secretion system [BR:epr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EPYR_00664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: CAY73028
UniProt: D2T472
Position
733403..733969
Genome map
AA seq 188 aa AA seqDB search
MSQHSDEGHKLLHGGYRQRRQQEGLNIRDKMQPSLLDRLTDNAPDNPREAAHSTLISHSA
LRRNVLRDLQWLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWQDIQRKLS
AAILNFEPRILPAGLQVRCVSDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENG
HFALRDMG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcacagcgatgaagggcataagctgctgcacggcggttaccgccagcgccgc
cagcaggaagggctgaacatccgcgacaaaatgcagccatcgctgctcgatcgtctgacc
gacaacgcgccggataatccgcgtgaagcggcgcacagcacgctgatctcgcacagcgcg
ctgcggcgcaacgtgctgcgcgacctgcagtggctgtttaataccattaacaatgaagcg
cagcaggatctgtcaccattcccgcatgtacagcgttcgacgctgaactttggcatttcg
ccgctggcggggcagcgcatgtcggatattgaatggcaggatatccagcgcaagctaagc
gcggcgatcctcaacttcgaaccgcgcattctgcccgccgggttacaggtgcgctgcgtg
tccgacaccagctcgcttgacctgcacaacgtgttgtcgattgagatcaagggccgcctg
tggtgcgtgccgtatccgctggaatttctgtttcgtaccgatgtggatctggaaaacggc
cattttgccctgcgtgatatgggttaa

DBGET integrated database retrieval system