KEGG   Erwinia pyrifoliae DSM 12163: EPYR_00835Help
Entry
EPYR_00835        CDS       T02121                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase,dihydrolipoyltransacetylase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00010  Glycolysis / Gluconeogenesis
epr00020  Citrate cycle (TCA cycle)
epr00620  Pyruvate metabolism
epr01100  Metabolic pathways
epr01110  Biosynthesis of secondary metabolites
epr01120  Microbial metabolism in diverse environments
epr01130  Biosynthesis of antibiotics
epr01200  Carbon metabolism
Module
epr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:epr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EPYR_00835 (aceF)
   00020 Citrate cycle (TCA cycle)
    EPYR_00835 (aceF)
   00620 Pyruvate metabolism
    EPYR_00835 (aceF)
Enzymes [BR:epr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EPYR_00835 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223 DUF3597
Motif
Other DBs
NCBI-ProteinID: CAY73215
UniProt: D2T532
Position
918895..920493
Genome map
AA seq 532 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDTVEVEQSILVVEGDKASMEVPSPQAGVVKEIKIA
TGDRVETGKLIMIFEAAGDAPAPAVAEEKQEAAPAAAAAAPAAASAAKEVNVPDIGGDEV
EVTEIMVKVGDKVEAEQSILTVEGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLVMVFD
VEGAAPAAAPAAKAEAPAPAAAKQEEKAAPAAAPAKAEAKSEFAENDAYVHATPVIRRLA
REFGVNLAKVKGTGRKSRILKEDVQSYVKDAVKRAEAPAAAGGGMPGMLPWPKVDYSKFG
EVEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFT
PVVFIMKAVAAALEQMPRFNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKG
IVELSRELTAISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKS
AMEPVWNGKEFMPRLMMPISLSFDHRVIDGADGARFITIINNTLADIRRLVM
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaatgttcctgatatcggggcggacgaagttgaagtcaccgagatc
ctggtcaaggttggcgacacggtagaagttgagcagtcgatactggtagttgaaggcgac
aaagcctcaatggaagtgccttcgccgcaggctggcgtggtgaaagagatcaaaatcgcc
accggcgaccgggttgaaaccggtaaactgattatgatcttcgaagcggctggcgatgcg
cctgcaccggcagtggctgaagagaagcaagaggcggctccggccgctgctgctgcggcc
ccggcggctgccagcgcggcaaaagaagtgaacgtaccggatatcggcggcgacgaagtt
gaagtgaccgagatcatggtcaaagtcggcgacaaggttgaagcggaacagtcgatcctc
accgttgagggcgacaaagcctcaatggaagtgcctgcaccattcgccggtacggttaaa
gagatcaaaatcagcgctggcgataaagtcagcaccggttctctggtaatggtctttgac
gttgagggcgcagcgcctgctgcggctccggcggcgaaagctgaagcgccagcacctgct
gcggctaagcaggaagaaaaagccgctccggcagcggctcctgctaaagcggaagcgaag
tctgaatttgcagaaaacgatgcctacgtgcacgccacgccggttatccgccgtctggcg
cgtgaattcggcgttaacctggcgaaggtcaagggcaccggacgcaaatcacgaattctg
aaagaagacgtgcagagctacgtcaaagacgcggtgaaacgcgccgaagcaccggcggct
gccggtggcggaatgccgggcatgctgccgtggccgaaagtggactacagcaagtttggt
gaagttgaagaagtggagctgggccgcatccagaaaatctctggtgccaacctgagccgt
aactgggtgatgatcccgcacgttacccacttcgacaaaaccgatatcaccgacctggaa
gcgttccgcaaacagcagaacgccgaagcagagaagcgcaagctggacgtgaagttcacc
ccggtggtgttcatcatgaaagccgttgccgctgcgcttgagcaaatgccgcgctttaac
agctcgctgtctgaagatgcgcagaagctgacgctgaaaaaatacatcaacatcggcgtg
gcggttgatacgccaaatggcctggtggtgccggtatttaaagacgtcaacaagaaaggg
attgttgagctgtcgcgtgaactgaccgccatctcgaaaaaagcgcgtgatggcaaacta
accgccggcgaaatgcagggcggctgcttcaccatctccagcattggcggcctggggacg
acccactttgcgccaatcgttaacgcgccggaagtggctatccttggcgtctccaagtcg
gcgatggagccggtgtggaatggtaaagagtttatgccgcgtctgatgatgccgatttcg
ctctccttcgaccaccgcgtgatcgacggtgcggacggtgcgcgcttcattaccatcatt
aataacaccctggccgacatccgccgtctggtgatgtag

DBGET integrated database retrieval system