KEGG   Erwinia pyrifoliae DSM 12163: EPYR_01119Help
Entry
EPYR_01119        CDS       T02121                                 

Gene name
guaA
Definition
(GenBank) GMP synthase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00230  Purine metabolism
epr01100  Metabolic pathways
Module
epr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:epr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EPYR_01119 (guaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:epr01002]
    EPYR_01119 (guaA)
Enzymes [BR:epr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     EPYR_01119 (guaA)
Peptidases [BR:epr01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   EPYR_01119 (guaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMP_synt_C GATase Peptidase_C26 NAD_synthase tRNA_Me_trans Asn_synthase ThiI PAPS_reduct ATP_bind_3
Motif
Other DBs
NCBI-ProteinID: CAY73499
UniProt: D2T6N1
Position
1215714..1217318
Genome map
AA seq 534 aa AA seqDB search
MTSPWNSPMTTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEEQIRGFNP
NGIILSGGPESTTEHDSPRAPDYVFNAGVPVLGVCYGMQTMALQLGGKVEGSSEREFGYA
QVEVKNQSALIRDIEDAIRADGKPLLDVWMSHGDKVTAIPSDFVTVASTDTCPFAIMANE
EKRFYGVQFHPEVTHTRQGLRLLERFVSDICQCEALWTPAKIIEDAVARLREQVGDDKVI
LGLSGGVDSSVTAMLLHRAIGDRLTCVFVDNGLLRLNEAEQVMEMFGDHFGLNIIHVAAE
NRFLDALAGTDEPEAKRKIIGRVFVEVFDEKATKLSDVKWLAQGTIYPDVIESAASATGK
AHVIKSHHNVGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPHAMLFRHPFPGPGLGVR
VLGEVKKEYCDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVS
LRAVETIDFMTAHWAHLPYEFLGRVSNRIINEIDGISRVVYDISGKPPATIEWE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgccctggaatagcccaatgacgacggaaaatattcataagcatcgcatcctg
atcctcgatttcggttcacagtacactcagctggttgcacgtcgcgtgcgtgagctgggc
gtctactgtgaactgtgggcgtgggatgttaccgaagagcagatccgtgggttcaacccg
aacggcatcatcctctccggcggcccggaaagcaccaccgagcacgacagcccgcgcgcc
ccggattacgtatttaacgccggcgtaccggtgctgggcgtgtgctatggcatgcagacc
atggcgctgcagctgggcggtaaggtggaaggctccagcgagcgcgagttcggctatgcg
caggtagaagtgaaaaaccagagcgcgctgatccgcgatatcgaagatgccatcagagcc
gacggtaagccgctgctggacgtgtggatgagccacggcgataaagtgaccgccatcccg
tctgattttgtcaccgttgccagcaccgatacctgcccgtttgccattatggctaacgag
gagaaacgcttctacggcgtgcagttccatcctgaagtaacgcatacccgccaggggctg
cgcctgctggaacgcttcgtaagtgatatctgccagtgcgaagcgttgtggactcctgct
aagatcatcgaagatgccgttgcgcgtttgcgcgagcaggtgggtgacgacaaagtgatc
ctcgggctgtcaggaggcgttgactcatcggttaccgcaatgctgctgcaccgcgccatc
ggcgaccgtctgacctgtgtatttgtggataacggcctgctgcgcctgaacgaagcggag
caggtgatggagatgttcggcgaccacttcggcctgaatatcatccatgtggcggcggaa
aaccgcttccttgacgcgctggccggtaccgacgaaccggaagccaagcgcaagattatt
ggtcgcgtatttgtggaagtattcgatgaaaaagccactaagctttctgatgtgaagtgg
ctggcacagggtactatctatcctgatgtgattgaatcagccgcttcggcgaccggtaag
gcgcatgtgatcaaatcgcaccacaacgtgggtggcctgccgaaagagatgaagctgggg
ctggttgagccgctgaaagagctgttcaaagatgaagtgcgcaaaataggccttgagctg
ggcttgccacacgccatgctgttccgccacccgttcccggggccaggtctgggcgtgcgc
gtgctgggcgaagtgaagaaagagtactgcgacctgctgcgccgtgccgatgctatcttt
attgaagagctacataaagccgacctgtacaacaaggtcagccaggcatttaccgtgttc
ctgccggtacgttccgttggcgtaatgggcgatggccgcaagtacgactgggttgtatcc
ctgcgtgcggtagaaaccatcgactttatgaccgcgcactgggcgcatctgccgtatgag
ttcctcggccgcgtttcaaaccgcatcatcaatgaaatcgacggtatttcccgcgtggtt
tacgatatctccggcaaaccaccggcgacgattgagtgggaatga

DBGET integrated database retrieval system