KEGG   Erwinia pyrifoliae DSM 12163: EPYR_03210Help
Entry
EPYR_03210        CDS       T02121                                 

Gene name
speB
Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
epr  Erwinia pyrifoliae DSM 12163
Pathway
epr00330  Arginine and proline metabolism
epr01100  Metabolic pathways
Module
epr_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:epr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EPYR_03210 (speB)
Enzymes [BR:epr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     EPYR_03210 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: CAY75590
UniProt: D2T6E4
Position
complement(3269844..3270767)
Genome map
AA seq 307 aa AA seqDB search
MNNTLNHEYDNSLVSNAFGFMRFPLNFQPYDSDAEWVITGVPFDAATSGRPGSRLGPGAI
RQISTNLAWEGCRWPWQFDLRQQLKVIDCGDLVYAFGDAQDFSDKLQAHAEKLLAKGKRM
LTFGGDHYISLPLLRAHAKTFGKMALVHFDAHTDTYSNGPTFDHGTMFYTAPKEGLISPE
HSVQIGIRTEFDPSLGFNVLDAAQVNDRSVDDILAQVKKIVGDLPIYLTFDIDCLDPAHA
PGTGTPVIGGLTSDKASKLIRGLQGMNIVGMDLVEVAPGYDQSDITALAAASLALDMLHV
QAANKIK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaccttaaaccacgagtacgataactctctggtctccaatgcttttggtttt
atgcgtttcccgcttaacttccagccctacgacagcgatgccgaatgggtgatcaccggc
gtgccttttgatgctgccacttctggccgccccggcagccgtctcggccccggggcaatc
cgacagatctccaccaatctggcctgggaaggctgtcgctggccgtggcagttcgatctg
cgccagcagctgaaggtgattgactgtggcgatctggtgtatgcctttggtgacgcgcag
gatttcagtgacaaactacaggcacatgctgaaaagctgctggcgaagggtaagcgcatg
ctcacctttggcggcgatcactatatcagcctgccgctgctgcgtgcgcatgcgaaaact
ttcggtaagatggcgctggtgcattttgatgcgcacacggacacctattccaatggccct
accttcgatcacggcaccatgttctatacggcaccaaaagaagggttgatctctcctgaa
cactccgtgcagattggtatccgtaccgaatttgatccttcgctgggctttaacgtgctg
gatgcggcgcaggttaacgatcgtagcgtggacgatatcctggcgcaggtgaaaaagatc
gtcggcgatctgcccatctatctgacctttgatattgactgccttgatccggcccatgca
ccgggcaccggcacgccggtgatcggcgggctgaccagcgacaaagccagcaagctgatc
cgtggcctgcagggcatgaacatcgtggggatggatctggttgaagtggctccgggttat
gaccagtctgatataactgcgctggcggctgccagcctggcgttagatatgctgcacgtc
caggctgccaacaagatcaaataa

DBGET integrated database retrieval system