KEGG   Erwinia pyrifoliae Ep1/96: EpC_04000Help
Entry
EpC_04000         CDS       T01000                                 

Definition
(GenBank) Putative Methionine-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00450  Selenocompound metabolism
epy00970  Aminoacyl-tRNA biosynthesis
epy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EpC_04000
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EpC_04000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:epy01007]
    EpC_04000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:epy03016]
    EpC_04000
Enzymes [BR:epy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EpC_04000
Amino acid related enzymes [BR:epy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EpC_04000
Transfer RNA biogenesis [BR:epy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EpC_04000
 Prokaryotic type
   Other AARSs
    EpC_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Cupin_2 tRNA-synt_1 AraC_binding tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: CAX54158
Position
complement(477651..479627)
Genome map
AA seq 658 aa AA seqDB search
MKITKNASKFSYGLNSSSLQFPVNTTGGMSCSLPPGAQSTFHRHHETELFLITSGKGRVH
IEGRESEDVVPEDIIYIDPLHGHTIENTCENEDLKFTALYWDNPNQTQRNDVPKDTLIIS
TPPTPNGDLHLGHLSGPYLGADIYRRYLTLKGVSARHLTGRDDNQTYVKCIATKEQRPPE
EVANDYADKIYQTWAKADIALDFFSSPQTTKNYYSRVNSIIGRLYDRGFIFAKEVDELYD
LNTGFSLHEGYIKGVCPHCHSASDGNACEQCGRPNDCADLINPVASLPETRVGTRTTTKL
YFRLSALAPQLTELTFRSNMSARARELTQGMLSDGLPDICISHRSDWGISVDIPGFEDQV
LYVWFEMAAGYLAADEDLHPQDPFFKNKNCDIIHFYGFDNTYYHTLLFPAIYYALDEEYN
VPVNHVINELLYLRGEKFSTSRRHLIWASKLLSKIPVDYVRWGLARSRPEMTNENFSLEP
FVDAINDFFVSTLQQHLTTSCRELSLQFQGKVPEPGAWTSQHAAFYQRIRNLARDVEHAY
HIDAFSPQTATAKLEEMGILTRKFFNAQSKHETQPMLRDYQRTTFALNFWAIKQFSLLSQ
PIMLEGSEYILKLLGLNFEGWDSDREDFIANSHTISACDENHFRIISKDIIEHVCQVN
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactaaaaatgcgtctaaatttagctatggattaaattcaagcagccttcaa
tttcctgtcaacacaacgggcggcatgtcatgttcactaccgccaggggcgcagtcaaca
tttcaccgccatcatgaaaccgagctttttttgatcacctctggtaaaggacgcgttcat
attgaagggcgcgaatccgaagatgtggtgccggaagatattatttatatcgatccgcta
cacggtcacactattgaaaatacctgcgagaatgaagatttaaaatttaccgcgctttat
tgggataaccccaaccaaacacagcgtaatgatgtgccaaaagatacgctgatcatttca
acgccgccgacgccaaacggtgatttacaccttgggcatttgtccggaccatatctgggc
gcagatatttaccgccgttacctgacgcttaaaggcgtctctgctcgtcatttaacaggg
cgggatgataaccagacctatgtcaaatgcattgccaccaaagagcagcgtcctcctgaa
gaggtcgccaatgattatgcggataaaatctatcagacttgggccaaagcagacattgct
ctggactttttctcaagtccgcaaacgacgaaaaattattacagtcgggtgaacagcatc
attggtcgcctctatgatcggggctttatcttcgctaaagaggtggacgaactctacgat
ctgaatacggggtttagccttcatgagggctacattaaaggcgtctgcccccactgtcat
agcgcttcagatggaaatgcctgtgagcagtgcggcagaccgaatgactgtgccgatctc
attaacccagtggccagcctccctgaaacccgggtcggtacccggacgactacaaagttg
tatttccgcctgtccgcccttgccccccaactcaccgagctgactttccgcagtaatatg
tccgcccgcgcccgcgaactgacgcagggaatgttgtctgacggtttaccggatatttgt
atctctcatcgctcagactggggcatttccgttgacatccccggatttgaagatcaggtt
ctctatgtctggttcgaaatggcggcaggctatctggcggctgatgaagatttacatcct
caggatccgtttttcaaaaataagaactgcgacatcattcatttctatggttttgataac
acctactatcacacattattattcccggccatctactatgcgttggatgaagaatataat
gtcccagttaatcatgttattaatgaactgctttatttgcgtggcgaaaagttttctacc
agccgccgtcacttgatctgggcctcaaaactgctgagtaaaataccggttgactatgtc
cgatgggggctagcccgctcgcgccccgaaatgaccaacgaaaacttcagcctcgaacct
tttgttgacgccattaacgacttttttgtcagcacgctgcagcaacatttgacgaccagt
tgccgtgaactgagcctgcaatttcagggaaaggtgcctgagccgggtgcatggacatcg
caacacgccgccttctatcagcggatcagaaatttagcccgtgacgtggaacatgcctat
cacattgatgctttctcgccgcaaacggcaacggccaagcttgaggaaatggggatttta
acgcggaaattttttaatgcgcagtcaaaacatgaaacccaaccgatgctgcgggattat
cagcgcaccactttcgcccttaatttttgggccataaagcaattttccctactttcccaa
cccattatgctggagggaagtgagtatatcctcaagctgcttggcctgaattttgaaggt
tgggatagcgatcgggaagattttattgcaaattctcacaccatatcagcgtgcgatgaa
aaccatttcagaatcatctcaaaagatattattgaacatgtttgccaggttaattaa

DBGET integrated database retrieval system