KEGG   Erwinia pyrifoliae Ep1/96: EpC_07930Help
Entry
EpC_07930         CDS       T01000                                 

Gene name
lpdA
Definition
(GenBank) Pyruvate dehydrogenase multienzyme complex, Dihydrolipoamide dehydrogenase component
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00010  Glycolysis / Gluconeogenesis
epy00020  Citrate cycle (TCA cycle)
epy00260  Glycine, serine and threonine metabolism
epy00280  Valine, leucine and isoleucine degradation
epy00620  Pyruvate metabolism
epy00630  Glyoxylate and dicarboxylate metabolism
epy00640  Propanoate metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
Module
epy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
epy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
epy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EpC_07930 (lpdA)
   00020 Citrate cycle (TCA cycle)
    EpC_07930 (lpdA)
   00620 Pyruvate metabolism
    EpC_07930 (lpdA)
   00630 Glyoxylate and dicarboxylate metabolism
    EpC_07930 (lpdA)
   00640 Propanoate metabolism
    EpC_07930 (lpdA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EpC_07930 (lpdA)
   00280 Valine, leucine and isoleucine degradation
    EpC_07930 (lpdA)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     EpC_07930 (lpdA)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EpC_07930 (lpdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored GIDA AlaDh_PNT_C HI0933_like NAD_binding_8 Thi4 FAD_binding_2 FAD_binding_3 Lycopene_cycl DAO
Motif
Other DBs
NCBI-ProteinID: CAX54572
Position
920760..922187
Genome map
AA seq 475 aa AA seqDB search
MSTEIKTQVVVLGAGPAGYSAAFRAADLGLETVIVERYSTLGGVCLNVGCIPSKALLHVA
KVIEEAKSLEAHGIVFGKPQTDIDKVRGWKEKVISQLTGGLAGMAKGRKVNVVNGLGKFT
GANTLEVTAEEGSKTTITFDNAIIAAGSRPIELPFIPHEDPRVWDSTDALELKEVPERLL
VMGGGIIGLEMATVYHALGSQIDVVEMFDQVIPAADKDVVKVFTKRISKQFNLMLETKVT
AVEAKEDGIYVTMEGKKAPSEPQRYDAVLVAIGRVPNGKGLDAGKAGVEVDDRGFIRVDK
QMRTNVPHIFAIGDIVGQPMLAHKGVHEGHVAAEVISGKKHYFDPKVIPSIAYTEPEVAW
VGLTEKEAKEQGISYETSTFPWAASGRAIASDCADGMTKLIFDKNTHRVIGGAIVGTNGG
ELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEIFEGSITDLPNPKAKKK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaattaaaactcaggtcgtggtacttggggcaggtcctgcaggctactct
gccgccttccgtgcagcggatttaggtctggagaccgttatcgttgagcgctacagcacc
ctgggcggtgtttgtctgaacgttggctgtatcccttctaaagccctgctgcacgttgcc
aaagtgattgaagaagccaaatcgttggaagcacacggcattgtcttcggcaagccgcag
actgatatcgataaagtgcgtggctggaaagaaaaagtcatctctcagctgaccggcggt
ttggccggtatggcgaaaggccgtaaggtcaacgtggttaacggccttggtaaattcacc
ggtgccaacacgctggaagtgaccgcagaagagggttcaaaaaccaccatcactttcgac
aatgcgattatcgccgccggttcgcgtcctattgaactgccgtttattccgcatgaagat
ccgcgcgtttgggattcaaccgatgcgctggagctgaaagaagtgccggaacgcctgctg
gtaatgggcggcggcattatcggcctggaaatggctaccgtttatcatgcgctgggttca
cagatcgacgtggtagagatgtttgatcaggtgatcccggctgcggacaaagacgtggtg
aaagtgttcaccaaacgtatttctaagcagttcaacctgatgctggaaaccaaagtgacc
gccgttgaagcgaaagaagacggtatctatgtcacgatggaaggcaaaaaagcgccgtcc
gaaccccagcgttacgacgcggtgctggtcgccattggtcgcgtacctaacggtaaaggt
ctggacgcgggcaaagccggtgttgaagtcgacgaccgtggctttatccgcgttgataag
cagatgcgtaccaacgtgccgcacattttcgccatcggcgatatcgttggtcagccgatg
ctggcgcacaaaggcgtgcatgaaggccacgtcgcggcagaagtgatctccggtaagaaa
cactacttcgacccgaaagtgatcccgtctatcgcctacaccgagccggaagttgcctgg
gtcggtctgaccgagaaagaagcgaaagagcaaggcatcagctatgaaacgtccaccttc
ccgtgggcagcttcaggccgcgccatcgcttccgactgtgcagacggcatgaccaagctg
atcttcgacaaaaacacccatcgtgtgatcggcggtgcgattgtcggcaccaacggcggc
gagctgctgggtgaaatcggtctggctatcgagatgggctgtgatgcggaagatatcgcg
ctgaccatccacgcgcacccaaccctgcatgaatcggttggcctggcggcggaaatcttc
gaaggcagcattaccgacctgccaaacccgaaagcgaaaaagaaataa

DBGET integrated database retrieval system