KEGG   Erwinia pyrifoliae Ep1/96: EpC_08010Help
Entry
EpC_08010         CDS       T01000                                 

Definition
(GenBank) Putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00071  Fatty acid degradation
epy00280  Valine, leucine and isoleucine degradation
epy00310  Lysine degradation
epy00362  Benzoate degradation
epy00380  Tryptophan metabolism
epy00620  Pyruvate metabolism
epy00630  Glyoxylate and dicarboxylate metabolism
epy00640  Propanoate metabolism
epy00650  Butanoate metabolism
epy00900  Terpenoid backbone biosynthesis
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
epy01212  Fatty acid metabolism
epy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EpC_08010
   00630 Glyoxylate and dicarboxylate metabolism
    EpC_08010
   00640 Propanoate metabolism
    EpC_08010
   00650 Butanoate metabolism
    EpC_08010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EpC_08010
   00072 Synthesis and degradation of ketone bodies
    EpC_08010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EpC_08010
   00310 Lysine degradation
    EpC_08010
   00380 Tryptophan metabolism
    EpC_08010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EpC_08010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EpC_08010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EpC_08010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epy04147]
    EpC_08010
Enzymes [BR:epy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EpC_08010
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EpC_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAX54580
Position
927877..929019
Genome map
AA seq 380 aa AA seqDB search
MIVAARRTPVGRAYGSLASVPPEALLAPLFNKLLPAGMTAIDEVIIGNATGGGGNIARLA
ALAAGVPMTVPAVTVDRQCGSGLEAVINACRLVQARAGECYLAGGVESVSNAPWRVEKPA
TLKQMPRFYPRARFSPDEIGDPDMGIAAENVARQCAISRERQDRFALRSHQRALAAAQQG
AFREEIVPLNLGHCLVENDECPRPGTSLAQLAALPPVFAADGSVTAGNCCPLNDGAALLL
VMSRRRARECGFTQGLLFADACSAGVDPNLLGLGPVPATEKLLRRQPGLTLDGVEVIEFN
EAFAAQVLASVDALGIDEHRINQQGGAIALGHPYGASGAIMVTRLFSQLVSQRQSEGYGL
AMLGIAGGLGLSALFKGVQL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtggccgcccgccgtactcctgtcggcagggcttatggttctctggccagcgtg
ccgccggaggcgctgctggccccgctgtttaacaaactgctgccagcaggtatgacggcg
attgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcgcggctggcg
gcgctggcggcgggcgtgccgatgaccgtgcctgccgtaacggtggacaggcagtgcggc
tccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggcgggcgaatgc
tatctggccggcggcgtagagagcgtcagcaacgcgccctggcgggtggagaagcccgcc
acgctaaagcagatgccgcgcttttaccctcgtgcacgtttttcaccggatgagatcggc
gatccggacatgggcatcgccgcggaaaacgtcgcgcgtcagtgcgccatcagccgggaa
cgccaggatcgctttgcgctgcgcagccaccagcgcgcgctggccgccgcgcagcagggc
gcattccgtgaggagatcgtcccgcttaacctgggccattgcctggtcgaaaatgacgag
tgcccgcgccccggcacctcgctggcgcagctggcggcattaccgccggtatttgccgcc
gatggctcggtgacggcgggtaactgctgtccgctgaatgacggggctgcgctgctgctg
gtgatgagccgacgcagggcgcgggagtgcggatttacccaggggctgctgtttgccgat
gcctgtagcgcaggcgttgacccgaatttacttggcctcggcccggttcccgccacggaa
aaactgctgcggcgtcagccgggcctgacgctggacggggttgaggtcattgagttcaat
gaagcctttgccgcccaggtgctggcatcggttgatgcactgggtatagatgaacacagg
atcaaccagcaggggggcgctattgctttggggcatccgtacggcgcttccggggcgata
atggtgacgcggctgttcagccagctggtcagccagcggcagagcgaaggctacggcctg
gcgatgctgggaatagctggcgggctggggctgagcgcattgtttaagggcgtgcagctg
taa

DBGET integrated database retrieval system