KEGG   Erwinia pyrifoliae Ep1/96: EpC_12370Help
Entry
EpC_12370         CDS       T01000                                 

Gene name
hisP
Definition
(GenBank) Histidine transport ATP-binding protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:epy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EpC_12370 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epy02000]
    EpC_12370 (hisP)
Enzymes [BR:epy01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     EpC_12370 (hisP)
Transporters [BR:epy02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    EpC_12370 (hisP)
   Histidine transporter
    EpC_12370 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase G-alpha AAA_16 AAA_23 PRK AAA_33 AAA_24 DUF87 RsgA_GTPase NACHT AAA_22
Motif
Other DBs
NCBI-ProteinID: CAX55016
Position
1427975..1428748
Genome map
AA seq 257 aa AA seqDB search
MAEKKLSVTELHKRYGEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TISVNNEYIKLVRDTDGQLKVSDKEQLRMLRTRLTMVFQHFNLWSHMTVLDNVMEAPVQV
LGLSKAQARERAIHYLDKVGIDQRAQGKYPMHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGKIEEEGPPEALF
SQPKSARLQQFLSGALK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaaaaattaagcgtgactgaactgcacaaacgttatggtgagcatgaggtg
ctgaaaggggtttcgctacaggcaaacgccggggacgtgatcagcattattggctcgtcc
ggctcaggtaaaagtaccttcctgcgctgcattaactttcttgaaaaaccgagcgaaggc
acgatttcggttaacaacgagtacatcaagctggtgcgagataccgacgggcagctgaaa
gtctccgacaaagagcagttacgcatgctgcgtacccgcctcaccatggtattccagcat
tttaatctgtggagccatatgacggtgctggataacgtcatggaagcgccggtgcaggtg
ctggggctgagcaaagcccaggcgcgtgagcgggccatccactatctggacaaagtcggc
attgaccagcgggcgcaaggtaaatatccgatgcatctgtcaggcggtcagcagcagcgc
gtctccattgcccgtgcgctggcgatggagccggaggtactgctgtttgatgagccgacg
tcggcgcttgacccggagctggtcggcgaggtgttgcgtattatgcagaagctggcagaa
gaggggaaaacgatggtggtggtcacgcatgaaatggagtttgcccgccatgtttccagc
catgtgattttcctgcatcagggcaaaattgaagaggaagggccgccggaagcgctgttc
agccagccaaaaagcgcgcgcctgcagcagtttctctcgggggcattgaagtag

DBGET integrated database retrieval system