KEGG   Erwinia pyrifoliae Ep1/96: EpC_14190Help
Entry
EpC_14190         CDS       T01000                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00340  Histidine metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01230  Biosynthesis of amino acids
Module
epy_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:epy00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    EpC_14190 (hisD)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EpC_14190 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh AIRS_C
Motif
Other DBs
NCBI-ProteinID: CAX55198
Position
complement(1629634..1630941)
Genome map
AA seq 435 aa AA seqDB search
MATAMTPIIWAQCSPQQQQALLTRPAVEASDSISATVRGILDKVKAEGDQALRDYSAAFD
KTQVDVLRVSEQQMADATERLDDEIKRAMAVAVANIDKFHLAQQLPAVDIETQPGVRCQQ
LTRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCGRVVLCSPPPIADEILYAAQLCGVK
EVFQVGGAQAIAALALGTESVPKVDKIFGPGNAWVTEAKRQVSQRLDGAAIDMPAGPSEV
LVIADEGATADFVASDLLSQAEHGPDSQVILLTPSVKMASAVAEAIQNQLAELPRAATAA
RALASSRLIVARDLQQCVEISNRYGPEHLIIQTRQARDLVDSITSAGSVFLGDWSPESAG
DYASGTNHVLPTYGYTSTCSSLGLADFQKRMTVQELTPQGFMGLAATIETLAAAEQLAAH
KNAVTLRVAALKEKP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgcgatgaccccgataatctgggcgcagtgtagcccgcagcagcagcaggcg
ctgctgacacgcccggcagttgaagcttctgacagcatcagcgccaccgtgcgtggcatt
ctcgacaaggtaaaagccgaaggtgaccaggcgctgcgtgactacagcgccgcttttgat
aaaacgcaggttgacgtgctgcgcgtcagcgagcagcagatggccgacgcgactgagcgg
ctggacgatgagatcaaacgggcgatggccgtggcggttgccaatatcgacaagtttcac
cttgcccaacagttgccagcggtcgatatcgaaacccagccgggcgtgcgctgccagcag
ctcacccgcccggtcgcgtcagtgggtttatatatccccggtggctctgccccgctgttc
tctaccgtattaatgctggcaacgccggcacgcatcgccggatgtggtcgggtggtgctc
tgttcgccaccgccgattgccgatgaaattctttatgccgcgcagctgtgtggcgtaaaa
gaagtgttccaggttggcggtgctcaggcgattgccgccctcgccctcggcaccgagtcg
gtgcctaaagtggacaaaattttcgggccgggtaatgcctgggtgaccgaagcgaagcgc
caggttagtcaacgtctcgacggcgcggcaatcgatatgcctgccgggccttcggaagtg
ctggtgattgccgacgaaggggccacggcggattttgtcgcctccgatctgctgtcgcag
gcggaacacggcccggactcacaggttatcctgcttacgccatcggtgaaaatggccagc
gccgtggccgaagccatccagaatcagctggctgaactgccgcgtgcggcaactgctgcc
cgggcgcttgccagcagccgtctgattgtcgcccgcgatctgcaacagtgcgtggagatc
agcaaccgctacgggcctgaacacctgattatccagacccgtcaggcgcgtgatttagtt
gatagcatcaccagcgccggatcggtgtttctcggggactggtcaccggaatctgccggc
gattacgcctcgggcaccaatcacgtcctgccaacctatggctatacttccacctgttcc
agcctcggactggccgacttccagaaaaggatgacggtgcaggaactgacgccgcaaggc
tttatggggctggcggcaacgattgaaaccctggctgccgccgaacagctcgccgcgcac
aaaaacgccgtgacgctacgcgttgccgccctgaaggagaagccatga

DBGET integrated database retrieval system