KEGG   Erwinia pyrifoliae Ep1/96: EpC_15740Help
Entry
EpC_15740         CDS       T01000                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
epy  Erwinia pyrifoliae Ep1/96
Pathway
epy00030  Pentose phosphate pathway
epy00480  Glutathione metabolism
epy01100  Metabolic pathways
epy01110  Biosynthesis of secondary metabolites
epy01120  Microbial metabolism in diverse environments
epy01130  Biosynthesis of antibiotics
epy01200  Carbon metabolism
Module
epy_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
epy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:epy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EpC_15740 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EpC_15740 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epy04147]
    EpC_15740 (zwf)
Enzymes [BR:epy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EpC_15740 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EpC_15740 (zwf)
Exosome [BR:epy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EpC_15740 (zwf)
  Exosomal proteins of colorectal cancer cells
   EpC_15740 (zwf)
  Exosomal proteins of bladder cancer cells
   EpC_15740 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA ThiW
Motif
Other DBs
NCBI-ProteinID: CAX55353
Position
1793643..1795118
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHEESRIIGVGRAEWDKAAYTK
VVREALETFMKEKIDEALWDKLSSRLDFCNLDVTDSSHFPRLGKMLDQKKRITINYFAMP
PSTFGAICQGLGEAKLNAKPARVVMEKPLGTSLVTSQEINNQVGEYFEESQVFRIDHYLG
KETVLNLLALRFANSLFAANWDNRTIDHVQITVAEEVGIEGRWGYFDKAGQMRDMIQNHL
LQVLTMIAMSPPADLSADRIRDEKVKVLRSLRRIDHTNVREKTVRGQYTSGFVQGKKVPG
YLEEEGANKSSNTETFVSIRVDIDDWRWAGVPFYLRTGKRLPTKCSEVVVYFKNPALNLF
KDSWQELPQNKLTIRLQPDEGVDIQILNKVPGLDHKHNLQTTKLDLSFSETFNQSHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSIMDAWSADKEAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggttacacaaacagcccaggcatgcgatctggttattttcggtgccaaaggcgac
cttgcacgccgaaaactgctgccctcactgtatcagttagaaaaagccggtcagattcat
gaagagtcacgcatcataggcgtggggcgtgcggaatgggataaagccgcttataccaag
gtcgtgcgtgaagcgctggaaacctttatgaaggaaaaaattgatgaggcgctgtgggat
aaactcagcagccgactcgatttttgtaatcttgacgtgactgacagcagtcatttccct
cgacttggcaaaatgctcgaccagaaaaaacgcatcaccatcaactattttgccatgccg
ccaagcacttttggtgctatttgtcaggggctgggcgaggccaaactcaatgccaaacca
gcacgcgtagtaatggaaaaaccgctgggcacctcgctcgttacttcgcaggaaattaac
aatcaggtaggtgagtacttcgaagaaagccaggtcttccgcattgaccattatctcggc
aaagagaccgtgcttaacctgctggcactgcgctttgctaactcgctgtttgccgcaaac
tgggacaatcgcactatcgaccatgtgcagataaccgtggcagaggaggtagggatcgaa
gggcgttggggctacttcgataaagccggtcagatgcgcgacatgattcagaaccacctg
ctgcaggtgttaaccatgatcgcgatgtcaccgccggcagatctgtctgctgaccgtatt
cgtgatgaaaaagtcaaggtactgcgctccctgcgccgcattgaccataccaacgtgcgt
gaaaaaaccgtacgcggccagtacacttcaggttttgtgcaggggaaaaaagtccctggc
tacctggaggaggagggcgcaaacaagtccagcaatacggaaaccttcgtttctatccgg
gttgatatcgacgactggcgctgggctggcgtgccgttctatctgcgcaccggtaaacgt
ctgccgaccaagtgttcggaagttgttgtctactttaaaaatccggcgctgaacctgttc
aaagacagctggcaggaactgccgcaaaacaaactgaccattcgtctgcagccggatgaa
ggcgtcgatatccagatcctcaacaaagtgcccggactggatcacaaacataacctgcaa
accaccaaactggatttgagcttctcagagaccttcaatcagtctcatctggcggatgcc
tacgagcgcctgctgctggaaaccatgcgcggtatccaggccctgtttgtacgtcgtgat
gaagtggaagaggcctggaagtgggttgattccatcatggatgcctggtctgcagataaa
gaagcgcctaaaccttaccaagcgggtacctgggggccggtggcttcggtagcgatgatc
acccgtgatggccgctcatggaatgaatttgaataa

DBGET integrated database retrieval system