KEGG   Erwinia pyrifoliae Ep1/96: EpC_24960Help
Entry
EpC_24960         CDS       T01000                                 

Definition
(GenBank) Putative hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
epy  Erwinia pyrifoliae Ep1/96
Brite
KEGG Orthology (KO) [BR:epy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EpC_24960
Enzymes [BR:epy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     EpC_24960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CAX56275
Position
complement(2769360..2770151)
Genome map
AA seq 263 aa AA seqDB search
MVKVALGQFAVKREWQENADICIGLMDQAYQQGARLLVLPEAVSARDTADPEWGIKAAQP
LDGPFLLLLLATSLHNTLTTVFTVHVPEGDGRVFNALIVIRQGRIIARYDKLHLYDAFTL
QESRNVTAGDRIPPLVDVDGINVGLMTCYDIRFPELARRLALDGADLLVLPSAWVRGPLK
EMHWQVSVIARALENTCYVAAVGECGPRNIGNSMVVDPLGVTIAQAAEGPALVVAEIDAQ
RIAEVRRALPVLVNRRFAPPQLL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagtggctttaggccagttcgcggttaagcgcgagtggcaggaaaatgccgat
atctgcatcggcttgatggatcaggcgtatcagcaaggtgctcgcttactggtcttgccg
gaggcggtgtcagctcgcgatactgccgacccggaatggggcataaaggccgcgcagcct
ctcgatgggccatttctgctgttgctgttggctacaagcctgcataacaccctgacgacc
gtgttcaccgtccatgtgccggagggggatggccgtgttttcaacgcgctgattgttatt
cgacagggcaggattatcgctcgctacgataagttgcatctttatgatgcctttaccctg
caggaatcacgcaatgttactgcgggcgatcgcataccgccgctggtggatgtcgatggg
atcaacgtcggactgatgacctgctatgacatccgtttcccggaactggcacggcggctg
gcgttggacggcgccgacctgctggtgctgccttctgcctgggtaagaggcccgcttaaa
gagatgcactggcaggtttcggtcatcgcacgcgcgctggaaaatacttgttatgtcgca
gcagtaggggaatgcggtccgcgtaacataggtaacagcatggtggttgatccgctcgga
gtcactattgctcaggctgcggaggggccagcgctggtggtggctgaaattgatgcgcag
cgaattgccgaagttcgccgtgctctaccggttctggttaaccggcgttttgcgccaccg
cagctgttataa

DBGET integrated database retrieval system