KEGG   Erwinia pyrifoliae Ep1/96: EpC_30220
Entry
EpC_30220         CDS       T01000                                 

Definition
(GenBank) conserved uncharacterized protein
Organism
epy  Erwinia pyrifoliae Ep1/96
SSDB
Other DBs
NCBI-ProteinID: CAX56801
Position
complement(3318195..3319598)
AA seq 467 aa
MNRYLLMTGIWLAASSLPAAAVDASLSSSGGSVSGAVSDGLFYSIGGGSVTSPPPSRSNM
SRLGLNGGWSSDLMCGNFDLKTTVGNQLNGITSGFKDLMGNVIQGATGAVMSMPAMAIQR
ANPGLYEMLTNGVLQAGINFDKGQLNCQNMSKKLADYTMGSKWQQAAVSEEYKDIVAGSG
GDAVSSDQKLQKATGEEGVTWVGGEKRGGKGQRAIQPTRDLAKAGYNMMNGLPVTSNNSV
AAASCNGSACQRYKTSDEASAAVVKVLGDRSIRTCRETSECASGGSENQPGSTIAGSGFS
PLLEDATKENLEQLGKLVNGQLPPTADNLAGIRTGSLVVTRGVIQALRDDQDKAALVQRL
AGELAMADTVETALTMRRMLTTGQSEPNAAGQTEAIAEGDRRIDALDREIAALRNEMELR
KSISSNSLLTTLERQGARNQDNRLQQTSGSEDQGFGRMGQTQPTGAN
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaacagatatcttctgatgaccggcatttggctggcagcatcctcgctgccggcagcg
gccgttgacgcgtcactctcttcttcaggcggatcggtaagcggggcggtcagtgatggc
ctgttttattccatcggcggtggatcggtgacctctccgccgcccagccgcagcaatatg
tcccgtctggggctcaacggcggctggagcagcgacctgatgtgcggcaacttcgacctg
aaaaccaccgtgggtaaccagctcaacggtattaccagcggcttcaaggatctgatgggc
aacgttatccagggcgcgacgggggcggtgatgagcatgccggcgatggccatccagcgg
gcgaatccggggctgtatgaaatgctgactaacggcgtattgcaggcgggtattaacttc
gacaaggggcagctcaactgccagaacatgtcgaagaagctggccgactatacaatgggc
agcaaatggcagcaggctgcggtgtcggaggagtataaggatatcgtcgctggcagcggc
ggtgatgccgtctccagcgaccagaaattgcagaaagctaccggcgaggagggcgtcacc
tgggtagggggcgagaagcgcggaggcaaggggcagcgcgccatccagccaacccgtgac
ctcgctaaagcgggctacaacatgatgaacggcctgccggtcaccagcaacaacagcgtt
gctgctgccagctgcaacggcagcgcctgccagcgttacaaaacctctgacgaggcgtcg
gcggcggtggtgaaagtgctgggcgaccgctccatccgtacctgccgggaaaccagcgag
tgtgccagcggcgggagcgaaaaccagccgggcagcaccattgccggtagcggtttctca
ccgctgctggaagatgccaccaaagagaaccttgagcagctgggtaagctggttaacggc
cagctgccgccgaccgccgataacctggccgggatcagaaccggcagtctggtggtcacg
cgcggggtgatacaggcactgcgcgacgatcaggataaggccgcgctggttcagcgtctt
gccggtgaacttgctatggccgacaccgtggagaccgcgctgaccatgcgccgtatgctc
accaccggtcaatcagaacctaacgccgccgggcagacggaagccattgccgaaggtgac
cgccgcattgatgcgctcgatcgcgaaatcgccgccctgcgtaacgagatggagctgcgt
aaatccatcagcagtaacagcctgctgaccacgctggagcgtcagggggcgcgcaatcag
gacaaccgcctgcagcagacgtccggcagtgaggatcaggggttcggcaggatggggcag
acgcagccgacgggagcgaactga

DBGET integrated database retrieval system